DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and AT1G08340

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_172310.1 Gene:AT1G08340 / 837354 AraportID:AT1G08340 Length:331 Species:Arabidopsis thaliana


Alignment Length:177 Identity:51/177 - (28%)
Similarity:78/177 - (44%) Gaps:30/177 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 LFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGS-REEGLLRIGGHKQKTELLYNELES 419
            :||||..::    |....:..:.||:.|..|...|..:|. :.||:.||.|...:.|.:..:|..
plant    45 VFGVSTESM----QLSYDSRGNCVPVILLLLQSRLYDQGGLQAEGVFRITGENSEEEFVREQLNK 105

  Fly   420 TFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSIDQMNALS---- 480
            ...  ||.:|       ||.|:.|:|.|.||||:.:|           ..|||...|...|    
plant   106 GII--PDGID-------VHCLAGLIKAWFRELPRGVL-----------DPLPSEQVMQCESDEDF 150

  Fly   481 -ILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSM 526
             .:..|||....:.|...::....:|..:.:||||..|:|.:.||:|
plant   151 VKVVRLLPQTEASLLNWAINLMADVIQFEHVNKMNSRNLALVFAPNM 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 51/177 (29%)
AT1G08340NP_172310.1 PBD 3..37 CDD:197628
RhoGAP 65..217 CDD:238090 45/153 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I2422
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.