DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and AT5G22400

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_197632.1 Gene:AT5G22400 / 832301 AraportID:AT5G22400 Length:466 Species:Arabidopsis thaliana


Alignment Length:330 Identity:82/330 - (24%)
Similarity:126/330 - (38%) Gaps:71/330 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 SKESRSENDARSQKKKSSEVLS-ASENECGRLLPMPYN----VLSF-----------ESICRDSS 289
            |..|.|.:.:.|....|...|| ||.:....|:...:|    |..|           |...|..|
plant     9 SSPSASHSSSSSSSSPSPSSLSYASRSNATLLISSDHNRRNPVARFDQDVDFHASIEEQDLRRRS 73

  Fly   290 SLDSCEVLDTCDIPSTLFTDVV------LISETDMKRLQTILWLELATI---------------F 333
            |.|..|..|..:...:|...:|      |||....:|       ||.::               |
plant    74 STDGGEEDDGGEDQISLLALLVAIFRRSLISCKSNRR-------ELCSMEIGWPTNVRHVAHVTF 131

  Fly   334 DRNK------VSLDKRKPFKRRRKEEGNLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLR 392
            ||..      |..:...| :|.......:||||..::    |....:..:.||..|..:...|..
plant   132 DRFNGFLGLPVEFEPEVP-RRAPSASATVFGVSTESM----QLSYDSRGNCVPTILLLMQNCLYS 191

  Fly   393 RGS-REEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLL 456
            :|. :.||:.|:.....:.|.:..:|...|.  |:.:|       ||.|:.|:|.|.||||..:|
plant   192 QGGLQAEGIFRLTAENSEEEAVREQLNRGFI--PERID-------VHCLAGLIKAWFRELPTSVL 247

  Fly   457 TNELIQLFYQCHTLPSIDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATI 521
            .:...:...||.|    ::.|.  .|..||||.....|...::....::..:.:||||..|:|.:
plant   248 DSLSPEQVMQCQT----EEENV--ELVRLLPPTEAALLDWAINLMADVVQYEHLNKMNSRNIAMV 306

  Fly   522 MAPSM 526
            .||:|
plant   307 FAPNM 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 48/172 (28%)
AT5G22400NP_197632.1 CRIB 115..155 CDD:238077 6/40 (15%)
RhoGAP 178..337 CDD:214618 43/149 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I2422
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.