DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and AT4G03100

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_192219.2 Gene:AT4G03100 / 828092 AraportID:AT4G03100 Length:430 Species:Arabidopsis thaliana


Alignment Length:257 Identity:58/257 - (22%)
Similarity:109/257 - (42%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 NLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELES 419
            ::||||..::.....:...:..:::.|..|:|..:   :|.:.||:.||.....:.|.:.::|..
plant   121 SVFGVSAESMQCSYDEKGNSVPTILLLMQERLYSQ---QGLKAEGIFRINPENSQEEHVRDQLNR 182

  Fly   420 TFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSIDQMNALSILCH 484
            ...  |:|:|       ||.|:.|:|.|.||||..:|.....:....|:|     :..::.::..
plant   183 GIV--PENID-------VHCLAGLIKAWFRELPSGVLDGLSPEEVLNCNT-----EDESVELIKQ 233

  Fly   485 LLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNSIAEQVRMAAQ 549
            |.|.|:. .|...:.....::..::.||||..|:|.:.||:|        :........:..|.|
plant   234 LKPTESA-LLNWAVDLMADVVEEEESNKMNARNIAMVFAPNM--------TQMTDPLTALMHAVQ 289

  Fly   550 CCRLTNILILRGEKLFQVPNNLIVESQKTMMGKKGWHRHRNSNEITAKPSGKASNVGVGHDS 611
            ...|...||.:          .:.|.::...|.:|:....:||..|...|..|.::.|..:|
plant   290 VMNLLKTLITK----------TLAEREENATGSEGYSPSHSSNSQTDSDSDNAQDMEVSCES 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 49/219 (22%)
AT4G03100NP_192219.2 PBD 80..113 CDD:197628
RhoGAP 140..298 CDD:214618 42/183 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I2422
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.