DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and ROPGAP3

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_850458.1 Gene:ROPGAP3 / 819283 AraportID:AT2G46710 Length:455 Species:Arabidopsis thaliana


Alignment Length:342 Identity:89/342 - (26%)
Similarity:130/342 - (38%) Gaps:72/342 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LLGYSR---IGTIQFPR---NRSVSDPFCSI---------GRSKESRSENDARSQKKKSSEVLSA 263
            :..:||   .|||.||.   .|...|.:.:|         |.|..|....|| |....|....|.
plant     1 MTNFSRSKSTGTIGFPEFKPTRPGPDKYENIHNDDDEYEEGHSTTSTDYYDA-STPLSSHASRSG 64

  Fly   264 SENECGRLLPMPYNVLSFESICRDSSSLDSC-------EVLDTCDI--PSTLFTDVVLISETDMK 319
            :.:..|:|     .|:...:.....|.:.||       :|:.:.||  |    |:|..:|.....
plant    65 NGSGSGQL-----TVVDLLAAVLRKSLVMSCAMERGEDDVVASMDIGWP----TEVKHVSHVTFD 120

  Fly   320 RLQTILWLELATIFDRNKVSLDKRKPFKRRRKEEGNLFGVSINALIRRDQQVTGTD-SSLVPLFL 383
            |....|.|         ...|:...| .|......::||||..::     |.:..| .:.||..|
plant   121 RFNGFLGL---------PSELEPEVP-PRAPSASVSVFGVSAKSM-----QCSYDDRGNSVPTIL 170

  Fly   384 EKLIGELLRRGS-REEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRW 447
            .::...|...|. :.||:.||.....|.|.:..:|         |...:.|...||.|:.|:|.|
plant   171 LRMQKRLYTEGGLKAEGIFRINPDNGKEEHVRRQL---------NCGVVPRGIDVHCLAGLIKAW 226

  Fly   448 LRELPQ---PLLTNELIQLFYQCHTLPSIDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKD 509
            .||||.   .:||.|.:.   :|:|      ....|.|..||||.....|...:.....::..:.
plant   227 FRELPTGVLDVLTPEQVM---RCNT------EEDCSRLVILLPPVESAILDWAIGLMADVVEHEQ 282

  Fly   510 INKMNVHNVATIMAPSM 526
            .||||..|||.:.||:|
plant   283 FNKMNARNVAMVFAPNM 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 52/176 (30%)
ROPGAP3NP_850458.1 CRIB 103..143 CDD:238077 12/53 (23%)
RhoGAP 167..323 CDD:238090 45/151 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I2422
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.