DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and ARHGAP39

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_079527.1 Gene:ARHGAP39 / 80728 HGNCID:29351 Length:1114 Species:Homo sapiens


Alignment Length:572 Identity:122/572 - (21%)
Similarity:198/572 - (34%) Gaps:190/572 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EYYLQ-SNSQSIEPEASYEDGEMEAEWLVSAG--YPELT--KPFEQGLEVSKKDLEPILTTLSKP 80
            |.||. |.|:.:...|.:|........:.|:.  :|..|  ||      .|:.|:|...:.....
Human   646 EPYLHPSQSEDLAACAQFESSRQSRSGVPSSSCVFPTFTLRKP------SSETDIENWASKHFNK 704

  Fly    81 HAEAIVQLVRTLNKTVRVRTKSRPKRKPDI----RDVFREFDEQGTVTR----SRSATPDSLD-S 136
            |.:.:.:  |.::....:...|...:||.|    |.|.:|..|...:.:    .|.|..|.|. :
Human   705 HTQGLFR--RKVSIANMLAWSSESIKKPMIVTSDRHVKKEACELFKLIQMYMGDRRAKADPLHVA 767

  Fly   137 LQI-DEAWTNNSLPTFVNVYEKNTETAIQCVEQSNEIYLKQNLRR------------TPSAPPKS 188
            |:: .:.|:...|         ..|..||...|:.|.:..::|.|            .|:  ||.
Human   768 LEVATKGWSVQGL---------RDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPT--PKF 821

  Fly   189 GTYAD--IFRGSQVRCDIPLYSADGVELLGYSRIGTIQFPRNRSVSDPFCSIGRSKESR--SEND 249
            .:|.:  |:|.                                  .||   :..:|.::  .|..
Human   822 HSYLEGYIYRH----------------------------------MDP---VNDTKVTQHIKELL 849

  Fly   250 ARSQKKKSSEVLSASENECGRLLPMPYNVLSFESICRDSSSLDSCEVLDTCDIPSTLFTDVVLIS 314
            .|:.||||..          |..|.||                                    :.
Human   850 ERNTKKKSKL----------RKKPKPY------------------------------------VE 868

  Fly   315 ETDMKRLQTIL-----WLELATIFDRNKVSLDKRKPFKRRRKEE----------GNLFGVSINAL 364
            |.|...:.|..     .|:.|.:       ...:|..|:...||          .::||.::   
Human   869 EPDGVAISTYAKYCYHKLQKAAL-------TGAKKGLKKPNVEEIRHAKNAVFSPSMFGSAL--- 923

  Fly   365 IRRDQQVTGTD-----SSLVPLFLEKLIGELLR-RGSREEGLLRIGGHKQKTELLYNELESTFYQ 423
                |:|.|..     ...:|....:|..|:|. .|.:.||:.|:.|...:...|  :|:...::
Human   924 ----QEVMGMQRERYPERQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNAL--KLQVDQWK 982

  Fly   424 NPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFY-QCHTLPSIDQMNALSILCHLLP 487
            .|..|::      .|..:||||.|.|||.:||:.:|    || ||  :...|...|...:.|.||
Human   983 VPTGLED------PHVPASLLKLWYRELEEPLIPHE----FYEQC--IAHYDSPEAAVAVVHALP 1035

  Fly   488 PENRNTLRSLLSFFNIIINLKD--INKMNVHNVATIMAPSMF-----PPRYI 532
            ..||..|..|:.|..:.:...:  :.||:|.|:|.:|||:..     .||.|
Human  1036 RINRMVLCYLIRFLQVFVQPANVAVTKMDVSNLAMVMAPNCLRCQSDDPRVI 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 55/191 (29%)
ARHGAP39NP_079527.1 WW 69..95 CDD:278809
MyTH4 767..907 CDD:279165 38/240 (16%)
RhoGAP_KIAA1688 919..1104 CDD:239854 55/190 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.