DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and tagap

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_012818622.1 Gene:tagap / 780157 XenbaseID:XB-GENE-1005061 Length:903 Species:Xenopus tropicalis


Alignment Length:592 Identity:117/592 - (19%)
Similarity:220/592 - (37%) Gaps:148/592 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 EAIVQLVRTLNKTVRVRTKSRPK-------RKPDIRDVFREFDEQGTVTRSRSATPDSLDSLQID 140
            |.|:....|::||:..|..|.|.       .||           :.||..|...      |:.|:
 Frog    16 EGILHNKNTIHKTLAQRRCSAPSLGFNKALSKP-----------RSTVWESNGC------SISIE 63

  Fly   141 EAWTNNSLPTFVNVYEKNTETAI-QCVEQSNEIYLKQNLRRTPS-----APPKSGT------YAD 193
            :.      |..:.:..:::|..: :||:.:.::..|:......|     |..||||      ..|
 Frog    64 QC------PFVLGLTSEDSELILHECVKLTQDLKTKERYLFLFSDMIIIAKLKSGTSFRLKHRVD 122

  Fly   194 IFRGSQVRCD--------IPLYSADGVELLGYSRIGTIQFPRNRSVSDPFCSIGRSKESRSENDA 250
            :.....:.|:        .|.:|                :|::..:....|: |.....||    
 Frog   123 LAEMMALPCEEEEEEEEACPFHS----------------YPKHALLFIWQCN-GCIASFRS---- 166

  Fly   251 RSQKKKSSEVLSASENECGRL--LPMPYNVLSFESI--CRDSSSLDSCEVLDTCDIPSTLFTDVV 311
            ...|:...:.|.....|.|.|  :.:||..|..:.:  |....::::..:.|..:.|        
 Frog   167 LEVKELWLDTLVWQIREVGGLEGISIPYTRLLMKVLTGCNAFKAINTSNMEDLIECP-------- 223

  Fly   312 LISETDMKRLQTILWL----ELATIFDRNKVSLDKRK-----PFKRRRKE-----------EGNL 356
              :|.|.|:.|.:..:    .:..:.:.||    |||     ||..||..           :..|
 Frog   224 --TEADAKKYQLLAAMISEDGMCHVIENNK----KRKAVISWPFTFRRSSTLSETSVPPELKATL 282

  Fly   357 FGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTF 421
            |...::.:...|         .:|..:.:::..|.::|...||:.|...:::..:.|..:|.|  
 Frog   283 FDQPLSIVCEED---------ALPKPILEILTILCQQGPSTEGIFRKAANEKARKELKEDLNS-- 336

  Fly   422 YQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSI-DQMNALSILCHL 485
               ...:|  .::..||.|:.:||.:||.:|..||::||...:......|:: :::..:..:...
 Frog   337 ---GKTVD--LKSKHVHLLAVVLKDFLRGIPHQLLSSELYHEWMAALEKPTLQEKIENMKCVADK 396

  Fly   486 LPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNSIAEQVRMAAQC 550
            ||..|...|:.|:.....|.....:|||:.:|:|..:.|:|..|   |...|.|:..|.:...:.
 Frog   397 LPRPNWILLQHLICVLYHISKASTLNKMDSNNLAVCIGPNMLQP---HHDYNLSLEAQKQANDRV 458

  Fly   551 CRLTNILI-----LRGEKLFQVPNNLIVESQKTMMGKKGWHRHRNSNEITAKPSGKASNVG---- 606
            ..|....|     |.|:.:          ||.....|:......:.:||..:.:..|.:..    
 Frog   459 ISLVEFFIDNCFDLFGQNV----------SQCLSTSKEELLEDTDVSEIPFQQNDSAYDSTDPEY 513

  Fly   607 VGHDSTV 613
            .||:||:
 Frog   514 EGHNSTI 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 48/225 (21%)
tagapXP_012818622.1 PH-like 78..177 CDD:302622 19/119 (16%)
RhoGAP_ARHGAP20 282..477 CDD:239867 48/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.