DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Arhgap15

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_722542.2 Gene:Arhgap15 / 76117 MGIID:1923367 Length:481 Species:Mus musculus


Alignment Length:343 Identity:74/343 - (21%)
Similarity:145/343 - (42%) Gaps:52/343 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 RSQKKKSSEVLSASENECGRLLPMPYNVLS-FESICRDSSSLD------SCEVLD--------TC 300
            :|.:|...::.:.|.||......:.:.:|. |::|   .:::|      ||..|:        :.
Mouse   158 KSSRKSVFQITTVSGNEFLLQSDIDFLILDWFQAI---KNAIDRLPKNPSCGSLELFNLQRSSSS 219

  Fly   301 DIPSTLFTDVVLISETDMKRLQTILWLELATIFDRNKVS--LDK---RKPFKRRRKEEG----NL 356
            ::||....|.........|.....|....:...|:|:|.  |.|   |:|..:..:|:|    .:
Mouse   220 ELPSHCHIDRKEQKPEHRKSFMFRLHHSASDTSDKNRVKSRLKKFISRRPSLKTLQEKGLIKDQI 284

  Fly   357 FGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHK---QKTELLYNELE 418
            ||..::.:..|:.       |.||.|:::.|..:.:||...:|:.|:.|:.   ||...:.|:.|
Mouse   285 FGSHLHTVCEREH-------STVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEE 342

  Fly   419 STFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQC-HTLPSIDQMNALSIL 482
            ..      |||: .:...:|.::..||.:.|||.:||......:.|.:. ....|.:::..:..|
Mouse   343 KL------NLDD-SQWEDIHVVTGALKMFFRELSEPLFPYSFFERFVEAIKKQDSNEKIETMRSL 400

  Fly   483 CHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNSIAEQVRMA 547
            ...|||.|.:|::.|......|:.....|.|:..::..:..|::.      .::|.|....|.|.
Mouse   401 VKRLPPPNHDTMKILFRHLTKIVAKASQNLMSTQSLGIVFGPTLL------RAENESGNVAVHMV 459

  Fly   548 AQCCRLTNILILRGEKLF 565
            .| .::...::...:|:|
Mouse   460 YQ-NQIAEFMLTEYDKIF 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 48/214 (22%)
Arhgap15NP_722542.2 PH 88..196 CDD:278594 8/40 (20%)
PH_ARHGAP9-like 89..198 CDD:270053 8/42 (19%)
RhoGAP_ARHGAP27_15_12_9 285..471 CDD:239868 46/206 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.