DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Arhgap8

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_006521531.1 Gene:Arhgap8 / 73167 MGIID:1920417 Length:480 Species:Mus musculus


Alignment Length:217 Identity:64/217 - (29%)
Similarity:100/217 - (46%) Gaps:36/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 FGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQ---KTELLYNELE 418
            ||||:..|..::|      ..|:|..|...:..|..:|.|.|||.|.....|   :.:.||::  
Mouse   248 FGVSLQYLRDKNQ------GELIPPVLRWTVTYLREKGLRTEGLFRRSASAQTVRQVQRLYDQ-- 304

  Fly   419 STFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSID---QMNALS 480
                ..|.|.|:.   ..:|..:.:||.:||||||||||   .|.:.|...:.|::   ::....
Mouse   305 ----GKPVNFDDY---GDMHLPAVILKTFLRELPQPLLT---FQAYEQILGITSVESSLRVTHCR 359

  Fly   481 ILCHLLPPENRNTLRSLLSFFNIIINLKDI-NKMNVHNVATIMAPSMFPPRYIHPSDN-NSIAEQ 543
            ::...||..|...||.|:.|.: .::|:.| ||||..|:|.:     |....|.||.. .|::..
Mouse   360 LILRSLPEHNYAVLRYLMGFLH-EVSLESISNKMNSSNLACV-----FGLNLIWPSQGVASLSAL 418

  Fly   544 VRMAAQCCRLTNILILRGEKLF 565
            |.:..    .|.:||...:|:|
Mouse   419 VPLNL----FTELLIEYYDKVF 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 64/217 (29%)
Arhgap8XP_006521531.1 CRAL_TRIO_2 87..220 CDD:372686
RhoGAP 248..436 CDD:383032 63/215 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.