DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Arhgap19

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_081943.2 Gene:Arhgap19 / 71085 MGIID:1918335 Length:494 Species:Mus musculus


Alignment Length:317 Identity:85/317 - (26%)
Similarity:140/317 - (44%) Gaps:81/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 LFTDVVLISETDMKRLQTILWLELATI-----------------FDRNKVSLDKRKPFKRRRKEE 353
            :||::|:   :::.||..:...|||.:                 |.|:.:||        :|||:
Mouse    56 VFTELVV---SNITRLIDLPGTELAQLMGEVDLKLPGGAGPAAGFFRSLMSL--------KRKEK 109

  Fly   354 GNLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELE 418
            |.:||..:            |:..:..::  :|| |.|.:..|.|||.|:.|:..:.:||.:.| 
Mouse   110 GVVFGSPL------------TEEGIAQIY--QLI-EYLHKNLRVEGLFRVPGNSVRQQLLRDAL- 158

  Fly   419 STFYQNPDNLDNLFRTATVH--ELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSID------- 474
                .|..::|  ..:...|  ::::|||.:|.|||:||||::...:..:...|...|       
Mouse   159 ----NNGTDID--LDSGEFHSNDVATLLKMFLGELPEPLLTHKHFHVHLKIADLMQFDDKGNKTN 217

  Fly   475 ------QMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIH 533
                  |:.||.:|..:|||.|||.|:.||.........:|.|||:.||:|.:.||.:..|:.:.
Mouse   218 IPDKERQIEALQLLFLILPPANRNLLKLLLDLLYQTAKKQDKNKMSAHNLALMFAPHVLWPKNVT 282

  Fly   534 PSD--NNSIAEQVRMAAQCCRLTNILILRGEKLFQVP------NNLIVESQKTMMGK 582
            .:|  .|.|.....||        .:|...:|||:.|      ..|.....:|.|.|
Mouse   283 ANDLQENIIKLNTGMA--------FMIKHSQKLFKAPAYIRECARLYYLGSRTQMSK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 66/242 (27%)
Arhgap19NP_081943.2 RhoGAP_ARHGAP19 113..320 CDD:239857 65/236 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..451
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.