DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and ARHGAP31

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_065805.2 Gene:ARHGAP31 / 57514 HGNCID:29216 Length:1444 Species:Homo sapiens


Alignment Length:232 Identity:61/232 - (26%)
Similarity:100/232 - (43%) Gaps:18/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 KRKPFKRRRKEEG--NLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIG 404
            |.|..|::.|.:|  :.||..:...:    :.:|.|   ||..| |...|.:......:|:.|:.
Human     2 KNKGAKQKLKRKGAASAFGCDLTEYL----ESSGQD---VPYVL-KSCAEFIETHGIVDGIYRLS 58

  Fly   405 GHKQKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHT 469
            |.....:.|..|..|.  |.||....:: ...:|.:.||.|.:.||||.||||.||.:.|.:..:
Human    59 GVTSNIQRLRQEFGSD--QCPDLTREVY-LQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAVS 120

  Fly   470 -LPSIDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIH 533
             .|...|:..:..:...|||.:..||..|:.....|.:......|:..|:|.:.||::...:.|.
Human   121 HCPEEGQLARIQNVIQELPPSHYRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLRSKEIE 185

  Fly   534 PSDNNSIAEQVRMAAQCCRLTNILILRGEKLFQVPNN 570
            .:..|..|..:.:..|...:..||    ..:.|:.||
Human   186 ATGCNGDAAFLAVRVQQVVIEFIL----NHVDQIFNN 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 56/216 (26%)
ARHGAP31NP_065805.2 RhoGAP_CdGAP 17..211 CDD:239849 53/208 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..427
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 504..631
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 688..893
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 906..1108
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1211..1346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.