DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and arhgap22

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_690970.4 Gene:arhgap22 / 562503 ZFINID:ZDB-GENE-090313-87 Length:698 Species:Danio rerio


Alignment Length:490 Identity:114/490 - (23%)
Similarity:189/490 - (38%) Gaps:142/490 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LKQNLRRTPSAPPKSGTYADIFRGSQVRCDIPLYSADGVELLGYSRIGTIQFPRNRSVSDPFCSI 238
            |...:|::..|..||....::.|||                   ||      |.:.|:.:.....
Zfish     5 LSPKIRQSRRARSKSMVMGELSRGS-------------------SR------PSSPSLQEQVVKA 44

  Fly   239 GRSKESRS----------------------ENDARSQ---KKKSSEV--LSASENECGRLLPMPY 276
            |..|:.||                      |.:.:.|   ..:.|:|  |:|:.:|.||.|    
Zfish    45 GWLKKQRSIMKNWQLRWFVLRTDHLYFYKDEEETKPQGCIPLQGSQVNELTANPDEPGRHL---- 105

  Fly   277 NVLSFESI--C---RDSSSLDSCEVLDTCDIPSTLFTDVVLISETDM----KRLQTILWLELATI 332
                ||.:  |   :|.|:|.....|            ::..|:.||    |.::.::|      
Zfish   106 ----FEIVPGCTGEKDRSALSHEAFL------------LMANSQNDMEDWVKAIRRVIW------ 148

  Fly   333 FDRNKVSLDKRKPFKRRRKEEGNLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSRE 397
                       .||      .|.:||..:...::.:::.   ...|.||.:|:.:..:..:|.:|
Zfish   149 -----------APF------GGGIFGQHLEDTVQYERKF---GPRLAPLLVEQCVDFIREQGLKE 193

  Fly   398 EGLLRIGGHKQKTELLYNELESTFYQNPDNLDN-LFRTAT-VHELSSLLKRWLRELPQPLLTNEL 460
            |||.|:.|...    |..||:..|    |..|. ||.:.| ||.::||||.:|||||:|::....
Zfish   194 EGLFRMPGQAN----LVKELQDAF----DCGDKPLFDSNTDVHTVASLLKLYLRELPEPVIPFNK 250

  Fly   461 IQLFYQCHTLPSIDQMNALSIL---CHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIM 522
            .:.|..|..|...|:...|..|   ...||..|.|.|:.:..|.:.:.:..:.|||:|.|:||:.
Zfish   251 YEDFLTCAQLLLKDEEMGLGELVKQVSTLPQANYNLLKYICKFLDEVQSHSNENKMSVQNLATVF 315

  Fly   523 APSMFPPRYIHPSDNNSIAEQVRMAAQCCRLTNILILRGEKLFQVPNNLIVESQKT---MMGKKG 584
            .|::..|:...|      ...:....|..:|..:||...|:|: |.|...|.|..|   ..|::|
Zfish   316 GPNILRPKIEDP------VSMMEGTTQVQQLMTVLISEHERLY-VGNERDVSSDHTGSCPRGQRG 373

  Fly   585 WHRHRNSNE------------ITAKPSGKASNVGV 607
            .....:..|            :....||.|:::.:
Zfish   374 MVEWISDEELLNCSSPSQISKVVESVSGSATSLDI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 65/224 (29%)
arhgap22XP_690970.4 PH-like 39..154 CDD:302622 28/157 (18%)
PH 41..147 CDD:278594 25/125 (20%)
RhoGAP_ARHGAP22_24_25 154..352 CDD:239855 61/214 (29%)
BAR <577..>683 CDD:299863
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.