DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and ARHGAP17

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_011544175.1 Gene:ARHGAP17 / 55114 HGNCID:18239 Length:913 Species:Homo sapiens


Alignment Length:303 Identity:78/303 - (25%)
Similarity:123/303 - (40%) Gaps:82/303 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 KKSSEVLSASENECGRLLPMPYNVLSFESICRDSSSLDSCEVLDTCDIPSTLFTDVVLISETDMK 319
            :|:..||..:..|.......|.|.|:    |.|       ||...|.:|              ::
Human   224 RKALAVLEKTLPEMRAHQGSPLNPLA----CVD-------EVWCRCSVP--------------LQ 263

  Fly   320 RLQTILWLELATIFDRNKVSLDK--RKPFKRRRKEEGNLFGVSINALIRRDQQVTGTDSSLVPLF 382
            .|.::.|..           |||  .||          .||..:...::|    :|.:   :.|.
Human   264 LLGSLSWCH-----------LDKWAEKP----------AFGTPLEEHLKR----SGRE---IALP 300

  Fly   383 LEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELEST------FYQNPDNLDNLFRTATVHELS 441
            :|..:..||..|.:||||.|||....|.:.|...|:.:      ||.:|            |.::
Human   301 IEACVMLLLETGMKEEGLFRIGAGASKLKKLKAALDCSTSHLDEFYSDP------------HAVA 353

  Fly   442 SLLKRWLRELPQPLLTNELIQLFYQCHTLPSID-QMNALSILCHLLPPENRNTLRSLLSFFNIII 505
            ..||.:|||||:||:|..|.:.:.|..::...| ::..|...|..|||:|....|.|:.|...:.
Human   354 GALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDLWRTCQKLPPQNFVNFRYLIKFLAKLA 418

  Fly   506 NLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNSIAEQVRMAA 548
            ...|:|||...|:|.::.|::...|     :..::||   |||
Human   419 QTSDVNKMTPSNIAIVLGPNLLWAR-----NEGTLAE---MAA 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 58/200 (29%)
ARHGAP17XP_011544175.1 BAR_Rich1 13..289 CDD:153302 22/110 (20%)
RhoGAP_nadrin 278..478 CDD:239851 60/213 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.