DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and arhgap17

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_002932512.1 Gene:arhgap17 / 549590 XenbaseID:XB-GENE-981776 Length:856 Species:Xenopus tropicalis


Alignment Length:218 Identity:61/218 - (27%)
Similarity:102/218 - (46%) Gaps:34/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 LELATIFDRNKV-SLDKRKPFKRRRKE---EGNLFGVSINALIRRDQQVTGTDSSLVPLFLEKLI 387
            ||....:.|..: :|:|..|..:.:::   |...||..:...::|    :|.:   :.|.:|..:
 Frog   216 LETQAEYHRKALAALEKALPEIQAQQDKWTEKPAFGTPLEEHLKR----SGRE---IALPIEACV 273

  Fly   388 GELLRRGSREEGLLRIGGHKQKTELLYNELEST------FYQNPDNLDNLFRTATVHELSSLLKR 446
            ..||..|.:||||.||.....|.:.|...|:.:      ||.:|            |.::..||.
 Frog   274 MMLLETGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDP------------HAVAGALKS 326

  Fly   447 WLRELPQPLLTNELIQLFYQCHTLPSIDQ---MNALSILCHLLPPENRNTLRSLLSFFNIIINLK 508
            :|||||:||:|..|.:.:.....:|  ||   :.||.::|..||..|....|.|:.|...:.:..
 Frog   327 YLRELPEPLMTFNLYEEWNHAGNIP--DQNTKLQALWVVCQKLPKPNLENFRYLVKFLAKLSHHS 389

  Fly   509 DINKMNVHNVATIMAPSMFPPRY 531
            |||||...|:|.::.|::...|:
 Frog   390 DINKMTPSNIAIVLGPNLLWARH 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 54/185 (29%)
arhgap17XP_002932512.1 BAR 13..257 CDD:386243 9/40 (23%)
RhoGAP_nadrin 246..445 CDD:239851 55/188 (29%)
DUF5585 515..>849 CDD:375359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.