DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Arhgap30

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001102547.1 Gene:Arhgap30 / 498282 RGDID:1561419 Length:1104 Species:Rattus norvegicus


Alignment Length:232 Identity:58/232 - (25%)
Similarity:101/232 - (43%) Gaps:19/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 LDKRKPFKRRRKEEGNLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIG 404
            :..|:..|::...:..:||..    :|...|.:|.:   ||..| :...|.::.....:|:.|:.
  Rat     1 MKSRQKGKKKGSSKERVFGCD----LREHLQQSGQE---VPQVL-RSCAEFVQEYGVVDGIYRLS 57

  Fly   405 GHKQKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHT 469
            |.....:.|..|.|:.  :.||...::: ...:|.:|||.|.:.||||.||||..|...|.:...
  Rat    58 GVSSNIQKLRQEFEAE--RKPDLRRDVY-LQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAEAVA 119

  Fly   470 LPSIDQMNALSILCHL--LPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYI 532
            : .::....:.||..|  ||..|..||..|:.....:.:......|:..|:|.:.||::...:.|
  Rat   120 V-QLEPERLVKILEVLQELPVPNYRTLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRSKDI 183

  Fly   533 HPSDNNSIAEQVRMAAQCCRLTNIL-----ILRGEKL 564
            ..|..|..|..:.:..|...:..||     :.||:.|
  Rat   184 EASGFNGTAAFMEVRVQSIVVEFILTHVDQLFRGDSL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 56/216 (26%)
Arhgap30NP_001102547.1 RhoGAP_CdGAP 16..210 CDD:239849 53/205 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.