DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and echdc1

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_031757537.1 Gene:echdc1 / 496886 XenbaseID:XB-GENE-958554 Length:330 Species:Xenopus tropicalis


Alignment Length:116 Identity:28/116 - (24%)
Similarity:48/116 - (41%) Gaps:23/116 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 KEEGNLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYN 415
            |.:..:..:.||...|.: ..|||    :.:.||:.|.: |......:||:..|.          
 Frog    84 KMDNGIAEICINNPSRMN-AFTGT----MMIELEERISD-LENWKNGKGLIVYGA---------- 132

  Fly   416 ELESTFYQNPDNLDNLFRTATVHE---LSSLLKRWLRELPQ-PLLTNELIQ 462
              |:||....| |:.:...:...|   :..|::..|..|.: ||::..|||
 Frog   133 --ENTFCSGSD-LNAVKAISNPQEGMMMCMLMQNTLTRLQRLPLISVALIQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 27/111 (24%)
echdc1XP_031757537.1 crotonase-like 86..273 CDD:119339 27/114 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.