DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Y92H12BL.7

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001364505.1 Gene:Y92H12BL.7 / 43578496 WormBaseID:WBGene00305050 Length:175 Species:Caenorhabditis elegans


Alignment Length:161 Identity:45/161 - (27%)
Similarity:73/161 - (45%) Gaps:37/161 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 VPLFLEKLIGELLRR--GSREEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLFRTATVHEL- 440
            :|..|..|| |||.:  |.|.|||.|:.|..::......:|:.            :....:|:. 
 Worm    13 LPWLLTTLI-ELLYQSGGRRTEGLFRVAGDPEQLATARGQLDG------------WLAPKMHDAN 64

  Fly   441 --SSLLKRWLRELPQPLLTNELIQLFYQCHTLPSIDQMNALSILCHLLPPENRNTLRSLLSFFNI 503
              :.|||.|||:||.||    ::...||...:.:.:...|:. |..|||..||      |....:
 Worm    65 VPAGLLKLWLRQLPVPL----ILPTLYQRALVAAENPAEAIR-LVDLLPEINR------LVLVRV 118

  Fly   504 IINLKDIN--------KMNVHNVATIMAPSM 526
            |..|:|::        ||:..|:|.::||::
 Worm   119 IALLQDLSREEVVAKTKMDTSNLAMVIAPNI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 45/161 (28%)
Y92H12BL.7NP_001364505.1 RhoGAP 1..162 CDD:413382 45/161 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.