DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and RhoGAP92B

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001287417.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster


Alignment Length:446 Identity:104/446 - (23%)
Similarity:175/446 - (39%) Gaps:117/446 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 GRSKESRSENDARSQKK---KSSEVLSASENECGRLLPMPYNVLSFESICRDSSSLDSCEVLDTC 300
            |....|..|.|.|::|.   |.::.|..|..|..:.:|:       :.:..:...|:  :.:..|
  Fly    57 GSGSGSSEEQDKRTKKNSHYKIAQALDESAKELPKDMPL-------QKVLANCGELE--KTMAEC 112

  Fly   301 DIPSTLFTDVVLISETDMKRLQTILWLELATI--FDRN--------------------------- 336
            .|.|.|.|:..::     :||:.||..|:..|  ..||                           
  Fly   113 IIESELETEAKVV-----RRLKNILDKEIQEISTLKRNVSRTLQEYTSLKRSHEAAIRLEEPAAK 172

  Fly   337 -----------KVSLDKRKP------------------------FKRRRKEEGNLFGVSINALIR 366
                       ::.|:|.:.                        ..:|...|..|  ..:||.:.
  Fly   173 VNHIKSQQEECELKLEKERDAWAAQMLELIAKEDEIVSCIRDYVLNQRNYHERAL--QHVNASLA 235

  Fly   367 RDQQ-VTGTDSSLVPLFLEKLIGE---------------LLRRGSREEGLLRIGGHKQKTELLYN 415
            |.|. :.||:.|.....|::.:..               ||..|..||||||:|....|...:.:
  Fly   236 RIQDTIQGTEKSRFGTSLKEHLTSTNREISYIVELCCCCLLEHGLEEEGLLRVGCASTKLRRMKH 300

  Fly   416 ELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQC---HTLPSIDQMN 477
            .||:...:.|..||    ....|.:.|:||.:|||||:||||..|.:.|.:.   |:  ..::..
  Fly   301 ALEAQHVKTPLPLD----YQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHS--EAERKT 359

  Fly   478 ALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNSIAE 542
            .:..:...||.||...||.|..|.:|:.....:|||:..|:|.:|:|:|..||.  ...:|:.|:
  Fly   360 EIKAILTKLPKENYANLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNMLWPRI--DKSSNAPAD 422

  Fly   543 ---QVRMAAQCCRLTNILILRGEKLF--QVPNNLIVESQKTMMGKKGWHRHRNSNE 593
               ||..::....:..:||.:.:..|  :|...|.::.||..:  :|..:..:|||
  Fly   423 YIGQVNSSSAANIIVELLISQWDYFFIGEVEFYLTLQKQKLFV--EGKSKSNSSNE 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 69/243 (28%)
RhoGAP92BNP_001287417.1 BAR 27..257 CDD:299863 38/215 (18%)
RhoGAP_nadrin 245..452 CDD:239851 60/214 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.