DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and preb

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001001231.1 Gene:preb / 407912 XenbaseID:XB-GENE-6456920 Length:422 Species:Xenopus tropicalis


Alignment Length:329 Identity:73/329 - (22%)
Similarity:111/329 - (33%) Gaps:115/329 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 PLYSA--DGVELL-------GYSRIG---TIQFPRNRSVSDPFCSIGRSKES-----RSENDARS 252
            ||||.  |.:..|       |.|:.|   .:.|.:...:|      ||...|     .:|:.|..
 Frog    16 PLYSVRIDPIRGLIITAGGGGASKTGIKNAVHFLQLEQIS------GRLSASLLHSHDTESRATM 74

  Fly   253 QKKKSSEVLSASENECGRLLPMPYNVLSFESICRDSSSLDSCEVLDTCDIPSTLFTDVVLISETD 317
            ....:.:|::|.::....:|  .|.|||.|                               ...|
 Frog    75 NMALAGDVIAAGQDSNCHIL--RYRVLSQE-------------------------------ERAD 106

  Fly   318 MKRLQTILWLELATIFDRNKVSLDKRKPFKRRRKE-----EGNLFG-------VSINALIRRDQQ 370
            ||:      .|.|...||.          .|.||.     :|.:.|       |||. |:...|.
 Frog   107 MKK------QEKAETNDRT----------SRNRKSSRVSIDGGIRGTKDETPEVSIE-LLHTVQT 154

  Fly   371 VTGTDSSLVPLFLEKLI------GELLRRGSREEGLLRIGGHKQKTELL----YN-ELESTFYQN 424
            .|..|:      |:|.:      .:||..|  .:|.||:.......:||    :| |:|. ...:
 Frog   155 DTSADT------LQKAVCFNPDCTKLLTGG--VDGYLRVWEFPGMKKLLDFKAHNGEIED-IASS 210

  Fly   425 PDN----LDNLFRTATVHELSSLLK--RWLRELPQPLLTNELIQLFYQCHTLPSIDQMNALSILC 483
            |.|    :...|| ..|.|...||.  .|...||.  :.:::.: :..|......||.:||.:..
 Frog   211 PGNKMVSVGQDFR-CCVWEADQLLMELHWNENLPS--IPDKMYR-YRACRFGKVPDQQDALCLYT 271

  Fly   484 HLLP 487
            ..:|
 Frog   272 VQIP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 38/156 (24%)
prebNP_001001231.1 WD40 repeat 17..68 CDD:293791 13/56 (23%)
WD40 repeat 74..109 CDD:293791 10/67 (15%)
WD40 repeat 161..196 CDD:293791 9/36 (25%)
WD40 164..>385 CDD:330360 28/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165167905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.