DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and RhoGAP71E

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001137956.1 Gene:RhoGAP71E / 39693 FlyBaseID:FBgn0036518 Length:906 Species:Drosophila melanogaster


Alignment Length:182 Identity:43/182 - (23%)
Similarity:76/182 - (41%) Gaps:34/182 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 FGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTF 421
            |||.:..:.:.:..:.|      ||.:  ||.:|.:.......:.|..||:...:.|.:.|::..
  Fly    40 FGVPLEEVCKHNNNIPG------PLLV--LILKLNKESPNRRDVFRAPGHQGAMKKLIHFLQAGR 96

  Fly   422 YQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLL--TNELIQLFYQCHTLPSIDQMNALSILCH 484
            ..|.||.       :|..::|:||::||::|..:.  :.|: :||.........:|...|..|..
  Fly    97 LVNVDNY-------SVFTIASVLKKFLRKIPNGIFGRSGEM-ELFAINDLQNEAEQTERLHRLFG 153

  Fly   485 LLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIM---------APSMF 527
            .||...::.|..|...|.:|.:       |..:.:|.|         |||.|
  Fly   154 SLPKYTQHLLVLLFGTFRVIAS-------NAAHASTGMTSEALGVSVAPSFF 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 43/182 (24%)
RhoGAP71ENP_001137956.1 RhoGAP 55..228 CDD:238090 40/167 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.