DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and tmem30a

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_989133.1 Gene:tmem30a / 394738 XenbaseID:XB-GENE-5816275 Length:365 Species:Xenopus tropicalis


Alignment Length:279 Identity:53/279 - (18%)
Similarity:94/279 - (33%) Gaps:104/279 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LNEYYLQSNSQSIEPEASYEDGEMEAEWLVSAGYPELTKPFEQGLEVSKKDLEPILTTLSKPHAE 83
            |:.:| |::.:.::   |.:|.::..:      ...||.|        .|:.||..|..|||.|.
 Frog   127 LSNFY-QNHRRYVK---SRDDSQLNGD------KNSLTNP--------SKECEPYRTNGSKPIAP 173

  Fly    84 -------------AIVQLVRTLNKTV-------------RVRTKSRPKRKPDIRDVF----REFD 118
                         .:.|:|....|.:             .|:.|:......::..||    :..:
 Frog   174 CGAIANSMFNDTLVLYQIVNGAEKQIPLVKKGIAWWTDKNVKFKNPTGNASNLEAVFAGTTKPIN 238

  Fly   119 EQGTVTRSRSATPDSLDSLQID-EAWTNN-SLPTFVNVYEKNTETAIQCVEQSNEIYLKQNLRRT 181
            .:..|.....:.||:...:..| ..|... :||||..:|        :.:|:::..|        
 Frog   239 WKKPVYELDPSEPDNNGFINEDFIVWMRTAALPTFRKLY--------RLIEKTDATY-------- 287

  Fly   182 PSAPPKSGTYADIFRGSQVRCDIPLYSADG--------VELLG---------YSRIGTIQF---- 225
            |:..|  |.|:.:     |..:.|:.|.||        :..:|         |..:|:|.|    
 Frog   288 PTLAP--GNYSLV-----VEYNYPVRSFDGRKRMILSTISWMGGKNPFLGIAYITVGSICFFLGV 345

  Fly   226 ----------PRNRSVSDP 234
                      .||.|...|
 Frog   346 VLFVIHHKYGNRNNSADIP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856
tmem30aNP_989133.1 CDC50 69..353 CDD:308793 49/266 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165167906
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.