DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and tagapa

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_005159011.1 Gene:tagapa / 393842 ZFINID:ZDB-GENE-040426-1877 Length:621 Species:Danio rerio


Alignment Length:288 Identity:67/288 - (23%)
Similarity:127/288 - (44%) Gaps:54/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 LDTCDIPST---LFTDVVLISETDMKRLQTILWLELATIFDRNKVSLDKRK---PFKRRRKE--- 352
            :|...:|:|   |.|.:.|..:|:.         .||:|.....:::::|:   .|:|.:|:   
Zfish    18 MDPISMPATTVPLNTGLSLCQQTNG---------NLASISHTGNMNINRRRWRSIFRRVQKKNKD 73

  Fly   353 ---------EGNLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQ 408
                     :..|||.:::.:.::|      .|...|: ::.|| .|.|:|...||:.|..|:.:
Zfish    74 LYHANSEHTKNTLFGRALSEICQKD------GSPPEPI-MDILI-LLQRKGLHTEGVFRRAGNTK 130

  Fly   409 KTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSI 473
            ..:.:..:|.       |.::...:...|..|:.|:|.:||.||..||.:|..:.:.........
Zfish   131 AVKEIKAQLN-------DGIEVDLKEHPVIWLADLIKDFLRHLPGGLLMSEKYKDWMDAMEKEDE 188

  Fly   474 DQMNA-LSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDN 537
            ||..| :.:|.:.||..|...|:.|:....:|....|.|||...|:||.::|::.      .:|:
Zfish   189 DQKCAEIKMLINTLPVPNIQLLKHLIVLLFLISEKADTNKMVSTNLATCVSPNLL------QTDS 247

  Fly   538 NSIAEQVRMAAQCCRLTNILILRGEKLF 565
            |     :....:..:||..||....::|
Zfish   248 N-----IEKMEEVTKLTAFLIDNCSRIF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 53/211 (25%)
tagapaXP_005159011.1 RhoGAP_ARHGAP20 86..273 CDD:239867 53/211 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.