DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and LOC365791

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_038959586.1 Gene:LOC365791 / 365791 RGDID:1359174 Length:847 Species:Rattus norvegicus


Alignment Length:561 Identity:108/561 - (19%)
Similarity:194/561 - (34%) Gaps:208/561 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 QVRCDIP---LYSADGVELLGYSR---IGTIQFPRNRSVSDPFCSIG------RSKE-------- 243
            :::|.||   |:..|.|||:..::   ..||.|         :.:.|      ||:|        
  Rat    46 KIKCIIPLNYLWVVDDVELVRANQTCTCKTIFF---------YWATGNALATFRSEEQKVQWYTF 101

  Fly   244 -SRSENDARSQKKKS-------SEVLSASENEC-------------GRLLPM------------- 274
             :||.::|:...||:       .::.:...:.|             .:||||             
  Rat   102 LTRSISEAKKGIKKTFPLHIFPEDIQTCDSSLCVTATNMDTVNDIMEKLLPMIRVHNIEDYQLWF 166

  Fly   275 ----------------PYNVLSFESICRDSSSLDSCEVLDTCDIPSTLFTDVVLISETDMKRL-- 321
                            ||::: ..::..:.|..:           |.:||...|:....|:..  
  Rat   167 SPGHKEAPRALQGHEYPYDII-MNNVQNNLSKSN-----------SKIFTAFPLLPGLFMENQSW 219

  Fly   322 ----QTILWLELATIFDRNKVSLDKRKPFKRRRK-----------------------EEGNLFGV 359
                |.||       ..|:.....::...|||||                       :.|.|||.
  Rat   220 DTGGQFIL-------KPRDSAGSQQQDAKKRRRKSCMTSCFHGGCVPHHDQECIRDDKRGKLFGQ 277

  Fly   360 SINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRI--GGHKQKT--ELLYNELEST 420
            .::::.:        |..|..:.|: ::..:..:|...:.:..|  .|...||  |.|.|.....
  Rat   278 DLSSICQ--------DGKLPTIILD-MLSRIKDKGPTTDDIFLITPNGSLCKTIKEKLDNGENVD 333

  Fly   421 FYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLP----SIDQMNALSI 481
            .||.|           ||.::.:||.:|:.:...|||:   :|:.|...:|    ..:::.|:..
  Rat   334 IYQQP-----------VHVVAWILKEFLQSIKGSLLTS---KLYDQWLIVPEKVNDKEKLAAVKS 384

  Fly   482 LCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPS-MFPPRYIHPSDNNSIAEQVR 545
            |...||..|.:.||.|....:.|.....:|.|:...::...||. ::.|.|.:....|.||:::.
  Rat   385 LLEKLPKPNADLLRQLFRILHQIKTNSSVNNMSSFRLSLETAPCILWLPSYRNNILTNDIAKKIS 449

  Fly   546 MAAQCCRLTNILILRGE---------KLFQVP-------------NNLIVESQKTMMGKKGWHRH 588
            :..  ..:.|...|.||         .|:..|             |.::.|::..:....|    
  Rat   450 LVT--FMIDNSPELFGEDIVAVWYETSLYHPPGLKYPCSQNTPSSNGIMEETEHGLSSCPG---- 508

  Fly   589 RNSNEITAKP-------SGKASNV----------GVGHDST 612
                |.|..|       ||.|:::          |.|::||
  Rat   509 ----ERTCTPDFDELPRSGAAASIPYEGILASEKGEGNEST 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 54/250 (22%)
LOC365791XP_038959586.1 PH-like 6..102 CDD:418428 15/64 (23%)
Ubiquitin_like_fold 115..230 CDD:421700 17/133 (13%)
RhoGAP_ARHGAP20 274..466 CDD:239867 50/216 (23%)
RhoGAP_ARHGAP20 562..766 CDD:239867
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.