DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and RhoGAP15B

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster


Alignment Length:572 Identity:126/572 - (22%)
Similarity:223/572 - (38%) Gaps:125/572 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VSKKDLEPILTTLSKPHAEAIVQLVRTLNKTVRVRTKSRPKRKPDIRD-VFREFDEQGTVTRSRS 128
            |.:..|.|:|.....|       |||..:..|....|....||..:|: .|:.|.:|...|....
  Fly   834 VPRPSLSPLLIRYEGP-------LVRFPSGVVEDILKEMQNRKAILRERQFQTFLDQEMKTPREM 891

  Fly   129 ATPDSLDSLQIDEAWTNNSLPTFVNVYEKNTETAIQCVEQSNEIYLKQNLRRTPSAPPKSGTYAD 193
            ...|::.:||.    .:||..|       :|.|...|.|             ..::.||:|..| 
  Fly   892 IPLDTITTLQC----VSNSRVT-------DTATHFYCFE-------------ITTSQPKNGNGA- 931

  Fly   194 IFRGSQVRCDIPLYSADGVELLGYSRIGTIQFPRNRSVSDPFCSIGRSKESRSENDARSQKKKSS 258
               |..:       |::...|:..|..|.:   :.:.||..:   |..||  ||.....||    
  Fly   932 ---GDAM-------SSNPNLLMTSSSSGNV---KQQRVSHLY---GVGKE--SERGVWMQK---- 974

  Fly   259 EVLSASENECGRLLPMPYNVLSFES-ICRDSSSLDSCEVLDTCDIPSTLFTDVVLISET------ 316
             :|.:..|.    ||:.|....:.: .|...:|:.| |...|..:.......::.:||.      
  Fly   975 -ILESLTNS----LPVKYTCHYYRAGWCYLKNSITS-EWSGTWLVLRKSQRRLIFVSEANGNVEK 1033

  Fly   317 -DMKRLQTILWLELATIFDRNKV--------------------SLDKRKPFKRRRKEEGNLFGVS 360
             |:::.:.|:..|.....|...|                    |..:.|.::...:|..:..|.|
  Fly  1034 MDLRKARCIVLKESDESIDNLHVESGPMLMIDCPPYAVYMIMSSARETKIWRHIIREVAHNNGFS 1098

  Fly   361 INALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTFYQNP 425
            :.     |||:|..|   ||:.::|.|..:...||..||:.|    |..:|...::|.|.|..:.
  Fly  1099 LG-----DQQLTRYD---VPVIVDKCINFVYIHGSMSEGIYR----KSGSENSMHKLMSAFRADA 1151

  Fly   426 DNLDNLFRTATVHELSSLLKRWLRELPQPL---LTNELI---QLFYQCHTLPSIDQMNA-LSILC 483
            .|::........|:::::|||::|:||:.|   ||:..:   :|......:|...::.| ||.: 
  Fly  1152 FNVEITRNEYNEHDVANVLKRFMRDLPERLLGKLTDSFVFVTELAVASEKIPIYRELLARLSAI- 1215

  Fly   484 HLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNSIAEQVRMAA 548
                  .|.|||.::.....|.:.:..|||:|.|:..|..|::...:    ||     |.:....
  Fly  1216 ------ERETLRRIVGHLVFISSQQAKNKMSVQNLTMIWGPTLLAKK----SD-----ELIYSQK 1265

  Fly   549 QCCRLTNILILRGEKLFQVPNNLIVESQKTMMGKKGWHRHRNSNEITAKPSG 600
            :...|:::::|. :.||....:.|...|..:...:.::....:.:...|.||
  Fly  1266 EADVLSDLVVLY-KNLFPCSADEIKREQAMLACLQKYYAAAETLKDAVKQSG 1316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 57/226 (25%)
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850 53/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.