DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Arhgap22

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_038950392.1 Gene:Arhgap22 / 306279 RGDID:1307237 Length:722 Species:Rattus norvegicus


Alignment Length:262 Identity:72/262 - (27%)
Similarity:121/262 - (46%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 LFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELEST 420
            :||..:...:..:::.   ...|.||.:|:.:..:..||..||||.|:.|...    |..:|:.:
  Rat   174 IFGQRLEDTVHHERKF---GPRLAPLLVEQCVDFIRERGLSEEGLFRMPGQAN----LVRDLQDS 231

  Fly   421 F--YQNPDNLDNLFRTAT-VHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSIDQMNA---L 479
            |  .:.|     ||.:.| ||.::||||.:|||||:|::.....:.|..|..|.:.|:...   |
  Rat   232 FDCGEKP-----LFDSTTDVHTVASLLKLYLRELPEPVIPFARYEDFLSCAQLLTKDEGEGTVEL 291

  Fly   480 SILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHP---SDNNSIA 541
            :.....||..|.|.||.:..|.:.:....|:|||:|.|:||:..|::..|:...|   .:..|:.
  Rat   292 AKQVSNLPQANYNLLRYICRFLDEVQAHSDVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLV 356

  Fly   542 EQVRMAAQCCRLTNILILRGEKLFQVPNNLIVESQK-TMMGKKGWHRHRNSNEITAKPSGKASNV 605
            :         .|..:||.:..:||..|:.....|.: |:.|...|    .|.|:|....|:..:.
  Rat   357 Q---------HLMTVLIRKHGQLFATPSFEEPASPRGTVQGTVEW----GSEEVTRDHQGEPGSS 408

  Fly   606 GV 607
            |:
  Rat   409 GL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 63/228 (28%)
Arhgap22XP_038950392.1 PH-like 42..157 CDD:418428
RhoGAP_ARHGAP22_24_25 173..371 CDD:239855 60/217 (28%)
SMC_prok_B <614..>704 CDD:274008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.