DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Arhgap15

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001013939.1 Gene:Arhgap15 / 295635 RGDID:1359304 Length:482 Species:Rattus norvegicus


Alignment Length:375 Identity:84/375 - (22%)
Similarity:149/375 - (39%) Gaps:70/375 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 PRNRSVSDPFCSIGRSKESRSENDARSQKKKSSEVLSASENE---------------------CG 269
            ||..:.|...|  |...|..:::  :|.||...::.:||.||                     ..
  Rat   138 PRPNAESVDLC--GAHIEWAAKD--KSSKKSVFQITTASGNEFLLQSDIDFLILDWFHAIKNAID 198

  Fly   270 RLLPMP-YNVLSFESICRDSSSLDSCEVLDTCDIPSTLFTDVVLISETDMKRLQTILWLELATIF 333
            ||...| :..|...|..|.|||          :.||....|.......:.|.....|...::...
  Rat   199 RLPKNPSFGSLELFSFQRSSSS----------EQPSHCHIDRKEQKPENRKSFMFRLHHSVSDTS 253

  Fly   334 DRNKVS--LDK---RKPFKRRRKEEG----NLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGE 389
            |:|:|.  |.|   |:|..:..:|:|    .:||..::.:..|:.       |.||.|:::.|..
  Rat   254 DKNRVKSRLKKFISRRPSLKTLQEKGIIKDQIFGSHLHTVCEREH-------STVPWFVKQCIEA 311

  Fly   390 LLRRGSREEGLLRIGGHK---QKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLREL 451
            :.:||...:|:.|:.|:.   ||...:.|:.|..      |||: .:...:|.::..||.:.|||
  Rat   312 VEKRGLEVDGIYRVSGNLATIQKLRFIVNQEEKL------NLDD-SQWEDIHVVTGALKMFFREL 369

  Fly   452 PQPLLTNELIQLFYQCHTLPSID-QMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNV 515
            .:||......:.|.:.......| ::..:..|...|||.|.:|::.|......|:.....|.|:.
  Rat   370 SEPLFPYSFFERFVEAIKKQDSDAKIETMKSLVKSLPPPNHDTMKILFGHLTKIVAKAAQNLMST 434

  Fly   516 HNVATIMAPSMFPPRYIHPSDNNSIAEQVRMAAQCCRLTNILILRGEKLF 565
            .::..:..|::.      .::|.|....|.|..| .::...::...:|:|
  Rat   435 QSLGIVFGPTLL------RAENESGNVAVHMVYQ-NQVAEFMLTEYDKIF 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 48/214 (22%)
Arhgap15NP_001013939.1 PH 88..197 CDD:278594 13/62 (21%)
PH_ARHGAP9-like 89..199 CDD:270053 13/64 (20%)
RhoGAP_ARHGAP27_15_12_9 286..472 CDD:239868 46/206 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.