DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Arhgap31

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001099349.1 Gene:Arhgap31 / 288093 RGDID:1306093 Length:1428 Species:Rattus norvegicus


Alignment Length:243 Identity:60/243 - (24%)
Similarity:105/243 - (43%) Gaps:17/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 KRKPFKRRRKEEG--NLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIG 404
            |.|..|::.|.:|  :.||..:...:    :.:|.|   ||..| |...|.:......:|:.|:.
  Rat     2 KNKGAKQKLKRKGAASAFGCDLTEYL----ESSGQD---VPYVL-KSCAEFIETHGIVDGIYRLS 58

  Fly   405 GHKQKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHT 469
            |.....:.|..|..|.  |.||....:: ...:|.:.||.|.:.||||.||||.||.:.|.:..:
  Rat    59 GVTSNIQRLRQEFGSD--QCPDLTREVY-LQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAVS 120

  Fly   470 -LPSIDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIH 533
             .|...|:..:..:...|||.:..||..|:.....|.:......|:..|:|.:.||::...:.|.
  Rat   121 HCPEEGQLARIQNVIQELPPPHYRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLRSKKIE 185

  Fly   534 PSDNNSIAEQVRMAAQCCRLTNILILRGEKLFQ--VPNNLIVESQKTM 579
            .:..|..|..:.:..|.. :...::...:::|.  .|..|..:..:|:
  Rat   186 ATICNGDAAFLAVRVQQV-VIEFILNHADQIFNGGAPGALQQDESRTI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 54/222 (24%)
Arhgap31NP_001099349.1 RhoGAP_CdGAP 17..211 CDD:239849 51/205 (25%)
DUF966 <1189..>1306 CDD:283735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.