DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Stard13

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001156965.1 Gene:Stard13 / 243362 MGIID:2385331 Length:1132 Species:Mus musculus


Alignment Length:421 Identity:97/421 - (23%)
Similarity:172/421 - (40%) Gaps:81/421 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 ELLGYSRI----GTIQFPRNRSVSDPF----CSIGRSKESRSENDARS-QKKKSSEVLSASENEC 268
            ||..:|.:    |...||....|:..|    .|.||:..|..|.|..| .:.:::.|....::..
Mouse   510 ELQSHSTLAGDPGLSPFPSPNQVTLDFEGNSVSEGRTTPSDVERDRTSLNESEATGVRERRDSGV 574

  Fly   269 GRLLPMPYNVLSFESICRDSSSLDSCEVLDTCDIPSTLFTDVVLISETDMKRLQTILWLELATIF 333
            |..|..|...|.:.|.           .|.....||.....:...:...:..||....|.|..|.
Mouse   575 GASLTRPNRRLRWSSF-----------QLSHQPQPSPATPHISSQTAAQLNLLQRFSLLRLTAIM 628

  Fly   334 DR----NK------------------VSLDKRK--PFKRRRK----EEGNLFGVSINALIRRDQQ 370
            ::    ||                  ||::.|.  .|.:|.|    .:..:|||.:...::|..|
Mouse   629 EKYSMSNKHGWTCLSAQSAPGALHDLVSVNSRSVPKFMKRIKAPDYRDKAVFGVPLIVHVQRTGQ 693

  Fly   371 VTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLFRTA 435
            .       :|..:::.:..|......:.||.|..|.|.:...| .::...|   |||:.  :...
Mouse   694 P-------LPQSIQQALRYLRSNCLDQVGLFRKSGVKSRIHAL-RQMNENF---PDNVS--YEDQ 745

  Fly   436 TVHELSSLLKRWLRELPQPLLTNELIQLFYQCHT-LPSIDQMNALSILCHLLPPENRNTLRSLLS 499
            :.::::.::|::.|:||:||.||:|.:.|...:. :|...::.|:.....||..|||..|::||.
Mouse   746 SAYDVADMVKQFFRDLPEPLFTNKLSETFLHIYQYVPKEQRLQAVQAAILLLADENREALQTLLC 810

  Fly   500 FFNIIINLKDINKMNVHNVATIMAPSMF---------PPRYIHPS------DNNSIAEQVRMAAQ 549
            |.:.::||.|.|:|...|:|..:|||:|         .|:.|...      |...:.|.:..|..
Mouse   811 FLHDVVNLVDENQMTPMNLAVCLAPSLFHLNLLKKESSPKVIQKKYATGKPDQKDLNENLAAAQG 875

  Fly   550 CCRLTNILILRGEKLFQVPNNLIVESQKTMM 580
            ...    :|....:||:||:.::.:|:.:.:
Mouse   876 LAH----MITECNRLFEVPHEMVAQSRDSYL 902

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 59/235 (25%)
Stard13NP_001156965.1 SAM_DLC2 57..120 CDD:188991
SAM 61..120 CDD:197735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..256
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..343
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 421..443
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 514..578 15/63 (24%)
RhoGAP_DLC1 676..893 CDD:239840 59/233 (25%)
SRPBCC 920..1123 CDD:301327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.