DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Arhgap22

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_006519017.1 Gene:Arhgap22 / 239027 MGIID:2443418 Length:738 Species:Mus musculus


Alignment Length:307 Identity:78/307 - (25%)
Similarity:135/307 - (43%) Gaps:48/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 SETDM----KRLQTILWLELATIFDRNKVSLDKRKPFKRRRKEEGNLFGVSINALIRRDQQVTGT 374
            |:.||    :.::.::|..|.....|:. .:...||.      ...:||..:...:..:::.   
Mouse   155 SQRDMEDWVQAIRRVIWAPLGRGTSRSS-HVHPVKPL------SAGIFGQRLEDTVHHERKF--- 209

  Fly   375 DSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTF--YQNPDNLDNLFRTAT- 436
            ...|.||.:|:.:..:..||..||||.|:.|...    |..:|:.:|  .:.|     ||.:.| 
Mouse   210 GPRLAPLLVEQCVDFIRERGLSEEGLFRMPGQAN----LVRDLQDSFDCGEKP-----LFDSTTD 265

  Fly   437 VHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSIDQMNA---LSILCHLLPPENRNTLRSLL 498
            ||.::||||.:|||||:|::.....:.|..|..|.:.|:...   |:.....||..|.|.||.:.
Mouse   266 VHTVASLLKLYLRELPEPVIPFARYEDFLSCAQLLTKDEGEGTVELAKQVSNLPQANYNLLRYIC 330

  Fly   499 SFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHP---SDNNSIAEQVRMAAQCCRLTNILILR 560
            .|.:.:....|:|||:|.|:||:..|::..|:...|   .:..|:.:         .|..:||.:
Mouse   331 KFLDEVQAHSDVNKMSVQNLATVFGPNILRPQIEDPVTIMEGTSLVQ---------HLMTVLIRK 386

  Fly   561 GEKLFQVPNNLIVESQKTMMGKKGWHRHRNSNEITAKPSGKASNVGV 607
            ..:||...:   :|...:..|...|    .|.|:|....|:..:.|:
Mouse   387 HGQLFAATS---LEEPASPHGTVEW----GSEEVTRDHRGEPGSPGL 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 63/228 (28%)
Arhgap22XP_006519017.1 PH-like 62..177 CDD:388408 5/21 (24%)
RhoGAP_ARHGAP22_24_25 193..391 CDD:239855 60/218 (28%)
Macoilin <529..>719 CDD:370635
HCR <638..719 CDD:284517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.