DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Arhgap25

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001032816.1 Gene:Arhgap25 / 232201 MGIID:2443687 Length:648 Species:Mus musculus


Alignment Length:313 Identity:78/313 - (24%)
Similarity:138/313 - (44%) Gaps:43/313 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 FTDVVLISETDMKRLQTILWLELATIFDRNKVSLDKRKPFKRR--RKEEGNLFGVSINALIRRDQ 369
            |...|:.:.:|..|:....::.:|:    ::|.:::...|.||  ....|.:||..::..:..:|
Mouse   110 FVFEVIPASSDQNRIGQDSYVLMAS----SQVEMEEWVKFLRRVAGTPSGAVFGQRLDETVAYEQ 170

  Fly   370 QVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLFRT 434
            :.   ...|||:.:||....:|..|..|||:.|:.|.    :.|..:|...|  :.....:..|.
Mouse   171 KF---GPHLVPILVEKCAEFILEHGVSEEGIFRLPGQ----DNLVKQLRDAF--DAGERPSFDRD 226

  Fly   435 ATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSIDQMNALSIL---CHLLPPENRNTLRS 496
            ..||.::||||.:||:||:|::.....:.|..|..|.:.|:..|...|   ...||.:|.|.|..
Mouse   227 TDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLMNADEAKAQQELVKQLSTLPRDNYNLLSY 291

  Fly   497 LLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNSIAEQVRMAAQCCRLTNILILRG 561
            :..|.:.|.....:|||:|.|:||::..::...:...|      |..:|...|..|:..::|...
Mouse   292 ICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDP------AVIMRGTPQIQRVMTMMIRDH 350

  Fly   562 EKLFQVPNNLIVE--SQKTMMGKKGWHRHRNSNEITAKPSGKASNVGVGHDST 612
            |.||....:..:.  :||              |:....|..::|   ||.|:|
Mouse   351 EVLFPKSKDAPISPPAQK--------------NDAKKAPVPRSS---VGWDAT 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 59/224 (26%)
Arhgap25NP_001032816.1 PH_RhoGap25-like 45..157 CDD:270083 10/50 (20%)
PH 47..149 CDD:278594 8/42 (19%)
RhoGAP_ARHGAP22_24_25 156..354 CDD:239855 57/212 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..559 9/48 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.