DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Arhgap11a

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_852081.2 Gene:Arhgap11a / 228482 MGIID:2444300 Length:987 Species:Mus musculus


Alignment Length:253 Identity:61/253 - (24%)
Similarity:108/253 - (42%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 RRRKE------EGNLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGEL----------LRRGSR 396
            |||.|      :|.:|||..|:|          ..|:||.|     |.:          |:....
Mouse    32 RRRHETAATEIKGKVFGVPFNSL----------PHSVVPEF-----GHIPSFLVDACASLKEHIH 81

  Fly   397 EEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELI 461
            .|||.|..|...:.:.|.::|        |..:....:|...:::.|||::.||||:|:|..:|.
Mouse    82 TEGLFRKSGSVVRLKALKSKL--------DQGEACLSSALPCDVAGLLKQFFRELPEPVLPADLH 138

  Fly   462 QLFYQCHTLPSIDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSM 526
            :..::...|.:.::..|..:|..|:.....:.||...:|...:......|||:..|:|.|.||::
Mouse   139 EALFKAQQLGAEERNKATLLLSCLMANPTVDILRYFFNFLKSVSLRASENKMDSSNLAVIFAPNL 203

  Fly   527 FPPRYIHPSDNNSIAEQVRMAAQCCRLTNILILRGEKLFQVPNNLIVESQKTMMGKKG 584
            ......|...:.:..:::|:.|   .:....|.....:.:|| :.|:|....|:|..|
Mouse   204 LQTSEGHEKMSANTEKKLRLQA---AVVQTFIDCASDIGRVP-DFILEKIPAMLGIDG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 53/229 (23%)
Arhgap11aNP_852081.2 RhoGAP-ARHGAP11A 46..246 CDD:239859 51/226 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..341
SH3-RhoG_link 371..>464 CDD:293215
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 632..669
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 700..756
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 960..987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.