DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Arhgap44

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_006532934.1 Gene:Arhgap44 / 216831 MGIID:2144423 Length:814 Species:Mus musculus


Alignment Length:416 Identity:102/416 - (24%)
Similarity:159/416 - (38%) Gaps:71/416 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 QVRCDI--PLYSADGVELLGYSRIGTIQFPRN---RSVSDPFCSIGR----SKESRSENDARSQK 254
            ||..|:  ||:      ||....|..||..|.   :.|.|...|..|    ||.|...:..:...
Mouse   115 QVERDVIEPLF------LLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAG 173

  Fly   255 KKSSEVLSASENECGRLLPMPYNVLSFESICRDSSSLDSCE-VLDTCDIPSTLFTDVVLISETDM 318
            .|:..:....|....|:           .||||..|.|... |....|..:...|.:.:.:|...
Mouse   174 AKADALREEMEEAANRV-----------EICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHR 227

  Fly   319 KRLQTILWLELATIFDRNKVSLDK---RKPFKRRRKEEGNLFGVSINALIRRDQQVTGTDSSLVP 380
            |.| |:|...|..|..:.:..::|   .||.:......|......|.|.:..             
Mouse   228 KSL-TLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLMISGREIAFPIEACVTM------------- 278

  Fly   381 LFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLK 445
                     ||..|.:||||.|:.....|.:.|...|:...      :|....:|..|.::..||
Mouse   279 ---------LLECGMQEEGLFRVAPSASKLKKLKAALDCCV------VDVQEYSADPHAIAGALK 328

  Fly   446 RWLRELPQPLLTNELIQLFYQCHTLPSID-QMNALSILCHLLPPENRNTLRSLLSFFNIIINLKD 509
            .:|||||:||:|.||...:.|...:...| ::.||...|..||..|.|.::.|:.|.:.:...:|
Mouse   329 SYLRELPEPLMTFELYDEWIQASNIQEQDKRLQALWNACEKLPKANHNNIKYLIKFLSKLSEYQD 393

  Fly   510 INKMNVHNVATIMAPSMFPPRYIHPSDNNSIAEQVRMAAQCCRLTNILILRGEKLFQVPNNLIVE 574
            :|||...|:|.::.|::..|:    |:.|.......::.|...:...:|...:..|  |.    |
Mouse   394 VNKMTPSNMAIVLGPNLLWPQ----SEGNITEMMTTVSLQIVGIIEPIIQHADWFF--PG----E 448

  Fly   575 SQKTMMGKKGWHRHRNSN-EITAKPS 599
            .:..:.|..|...|.|.| ..::.||
Mouse   449 IEFNLTGSYGSPVHVNHNANYSSMPS 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 54/220 (25%)
Arhgap44XP_006532934.1 BAR_Rich2 13..260 CDD:153303 40/162 (25%)
RhoGAP 249..449 CDD:383032 57/237 (24%)
PHA03247 <529..809 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.