DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and rga-3

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_504503.1 Gene:rga-3 / 178961 WormBaseID:WBGene00019600 Length:1085 Species:Caenorhabditis elegans


Alignment Length:233 Identity:50/233 - (21%)
Similarity:98/233 - (42%) Gaps:39/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 VPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELE-STFYQNPDNLDNLFRTATVHELSS 442
            ||.|:......:.:.|...:|:.|    |:...:..|..| ...|:...::.|.:   :|.::.:
 Worm    65 VPKFIVNAFNIISKHGMDTDGIFR----KEGNSVRLNRAEVQAIYKGQRDIPNDY---SVIDVCT 122

  Fly   443 LLKRWLRELPQPLLTNE-----LIQLFYQCHT----LPSIDQM--------NALSILCHLLPPEN 490
            ::||:||:|..|||.:|     |::...|...    |.:.|:|        ..:.....||...:
 Worm   123 MVKRFLRDLKPPLLDSEECRARLLKKACQARISDGFLMTRDEMADVFYMEDRTIEQQTPLLSDAH 187

  Fly   491 RNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMF---------PPRYIHPSDNNSIAEQ--- 543
            .:||..::...|.|....:.:||::.|:|.:...|:|         .|:....|..:.:|::   
 Worm   188 ASTLGYVMRQLNRIAAHSEQHKMSIENLAIVFIGSVFGDGIHDSKKTPQLRRGSKEDILAQKRHE 252

  Fly   544 --VRMAAQCCRLTNILILRGEKLFQVPNNLIVESQKTM 579
              |..||....:||..::...:...|.:|.::.|...|
 Worm   253 MNVNTAAVKLLITNANLIGVRRDPYVTSNAMLRSSSAM 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 48/228 (21%)
rga-3NP_504503.1 RhoGAP 63..232 CDD:214618 38/173 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.