DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and chin-1

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_497323.3 Gene:chin-1 / 175268 WormBaseID:WBGene00015267 Length:421 Species:Caenorhabditis elegans


Alignment Length:177 Identity:49/177 - (27%)
Similarity:80/177 - (45%) Gaps:19/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 LFGVSINALIRRDQQVTGTD-SSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELES 419
            :|||.|..|.    ...|.| ..:|||    .|||:..||...||:.|:.|.....|.|..:.:|
 Worm   231 MFGVDITTLC----MAHGADLPPIVPL----CIGEVESRGLDVEGIYRVSGSYDHMEKLKQQFDS 287

  Fly   420 TFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLT----NELIQLFYQCHTLPSIDQMNALS 480
            ..|.      :|.....:|.:..|||.:.|.|||.|:.    .:|:..:.:.:...:.::...:.
 Worm   288 NQYV------DLATVCDIHTVCGLLKLYFRLLPQQLIPFSVHKQLLVAYQETNQRSTHERERQIR 346

  Fly   481 ILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMF 527
            .:...|...|..||.::|:....:.:....|||.|.|:|||.:|::|
 Worm   347 KVMMELSDANIITLGAVLAHLKKVADHSAKNKMTVENLATIFSPTLF 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 49/177 (28%)
chin-1NP_497323.3 SH2_a2chimerin_b2chimerin 43..130 CDD:198215
C1_1 172..224 CDD:278556
RhoGAP 248..413 CDD:238090 42/156 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.