DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and rga-1

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001022390.1 Gene:rga-1 / 174751 WormBaseID:WBGene00012203 Length:444 Species:Caenorhabditis elegans


Alignment Length:155 Identity:40/155 - (25%)
Similarity:72/155 - (46%) Gaps:6/155 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 VPLFLEKLIGELLRRGSREEGLLR----IGGHKQKTELLYNELESTFYQNPDNLDNLFRTATVHE 439
            :|..:::||..|.......||:.|    ||..|:..:.:....:..|..:|:..||.: .|::| 
 Worm   262 IPPIVDQLIEYLEAHALTMEGVFRKSANIGSIKRLQDRINKGEKIDFENDPEYKDNEY-VASLH- 324

  Fly   440 LSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSIDQMNALSILCHLLPPENRNTLRSLLSFFNII 504
            .|.|||.:.|.|.:||.||.|.........:...::..|:.....|||.||...|::::.|...:
 Worm   325 ASVLLKTFFRSLGEPLTTNRLYPKLAALSEVSKTEKSAAVKEFVKLLPRENYILLKTVIKFLTRV 389

  Fly   505 INLKDINKMNVHNVATIMAPSMFPP 529
            .....:|.|..:|::.:..|::..|
 Worm   390 AENSKVNLMTANNLSVVFGPNLTWP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 40/155 (26%)
rga-1NP_001022390.1 SEC14 74..225 CDD:214706
RhoGAP 242..442 CDD:383032 40/155 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.