DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and hum-7

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001248880.1 Gene:hum-7 / 171650 WormBaseID:WBGene00002040 Length:1880 Species:Caenorhabditis elegans


Alignment Length:569 Identity:121/569 - (21%)
Similarity:210/569 - (36%) Gaps:135/569 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 NKTVRVRTKSR---PKRKPDI-----RDVFREFDEQGTVTRSRSATPDSLDSLQIDEAWTNNSLP 149
            |.|..||:.:|   |||..|:     |.........||.:.:::       ..|||..       
 Worm  1285 NPTSPVRSPTRLHSPKRPWDLMPHKQRQSSSPIPSTGTFSLTKT-------KQQIDPG------- 1335

  Fly   150 TFVNVYEKNTETAIQCVEQSNEIYLKQNLRRTPSAPPKSGTYAD-IFRGSQVRCDIPLYSADGVE 213
               |:..::|:...|.     .|::....|....:..|..|..| :|:.|        ..|..:|
 Worm  1336 ---NMLVESTDDLRQF-----SIFIFNKTRHLNESNAKRDTVVDAVFKKS--------LRAFHME 1384

  Fly   214 LLGYSRI---------------------------GTIQFPRNRSVS------DPFCSIGRSKESR 245
            ||||..:                           .::.||....|:      :.:..:...|:..
 Worm  1385 LLGYEAVLSVEQSVLKYRDVITMFEGLLTKVCLEESVSFPTTLGVNAFRGFLNEYVHVQSKKKRG 1449

  Fly   246 SENDARSQKKKSSEVLS--ASENECGRLLPMPYNVLSFESICRDSSSLDSCEVLDTCDIPSTLFT 308
            .|..:..:|.....|.|  |:.:...|......:|.::..:|  :..:...|.|.||        
 Worm  1450 KEKSSMIKKVGKKRVKSDVAAVHAGHRFRAEAVHVPTYCEVC--NQLIWHHEKLYTC-------- 1504

  Fly   309 DVVLISETDMKRLQTILWLELATIFDRNKVSLDKRKPFKRRRK------EEGNLFGVSINALIRR 367
              |....:..|:.|.             ||:    .|.:...|      ..|..||.|:.:::  
 Worm  1505 --VACRISCHKKCQP-------------KVT----HPCQMTGKAIDPKTNGGRFFGASLVSIV-- 1548

  Fly   368 DQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLF 432
                  .|...||..|::|...:..|....||:.|..|...:...:...:|||...:..||::: 
 Worm  1549 ------DDDHTVPTLLDRLFFAIETRALFVEGVYRKSGSLPQVRSIRKVIESTADADSVNLEDI- 1606

  Fly   433 RTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSI-DQMNALSILCHLLPPENRNTLRS 496
               .||.|::|:|.:.|||.:|::..:|.:.|.....:..: :::..||::..|||..||..|..
 Worm  1607 ---GVHVLTTLVKAFFRELAEPIIIFDLYENFLNVSEVEDMGERVRCLSVMIELLPKPNRAVLDR 1668

  Fly   497 LLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNSIAEQVRMAAQCCRLTNILILRG 561
            |:.....:.:.:.:|||..:|:|.|     |.|..:...|:....||:...|:.......||...
 Worm  1669 LMYHLARVADQEAVNKMGCNNLALI-----FGPCVLRRQDSAHAQEQLNDVARQTGCVQTLIEEK 1728

  Fly   562 EKLFQVPNNLIVE----SQKTMMGKKGWHRHRNSNEITAKPSGKASNVG 606
            .|.::...:.|||    |||.....:....||.::|    ||..:.|:|
 Worm  1729 LKQYKATIHNIVELEDASQKVSANLRKIEEHRRNSE----PSKFSPNIG 1773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 56/224 (25%)
hum-7NP_001248880.1 RA 28..134 CDD:214612
MYSc 163..936 CDD:214580
MYSc_Myo9 181..936 CDD:276836
C1 1234..1284 CDD:237996
C1 1475..1523 CDD:237996 12/76 (16%)
RhoGAP 1540..1727 CDD:295372 52/203 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.