DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and ARHGAP42

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_689645.2 Gene:ARHGAP42 / 143872 HGNCID:26545 Length:874 Species:Homo sapiens


Alignment Length:409 Identity:94/409 - (22%)
Similarity:159/409 - (38%) Gaps:94/409 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 FCSIGRSKE--SRSENDARSQKKKSSEVLSASENECGRLLPMPYNVLSFESICRDSSSLDSCEVL 297
            :|:..:..:  :.|.::.:|..|.:..|.|:.|                      ...|.||...
Human   288 YCTYDKGSKTFTMSVSEMKSSGKMNGLVTSSPE----------------------MFKLKSCIRR 330

  Fly   298 DTCDIPSTLFTDVVLISETDMKRLQTI------LWLELATIFDRNKVSLDKRKPFKRRRKEEGNL 356
            .|..|......|:.::....:..||..      ||||          ::|.::|.          
Human   331 KTDSIDKRFCFDIEVVERHGIITLQAFSEANRKLWLE----------AMDGKEPI---------- 375

  Fly   357 FGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTF 421
              .::.|:|.:.:::...::..  .|:.|.|..:..||....||.||||...|.:.|.|   :||
Human   376 --YTLPAIISKKEEMYLNEAGF--NFVRKCIQAVETRGITILGLYRIGGVNSKVQKLMN---TTF 433

  Fly   422 Y-QNPDNLD---NLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCH-----TLPSIDQ-- 475
            . ::|.::|   .|:...|:   :|.||.:||.|.:||:|       |:.|     .:.|.||  
Human   434 SPKSPPDIDIDIELWDNKTI---TSGLKNYLRCLAEPLMT-------YKLHKDFIIAVKSDDQNY 488

  Fly   476 -MNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNS 539
             :.|:..|.|.||.:||..|..|:.....:......|.|.|.|:..|..|::.      .:...:
Human   489 RVEAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTLM------RAQEET 547

  Fly   540 IAEQVRMAAQCCRLTNILILRGEKLFQ-VPNNLIVESQKTMMGKKGWHRHRNSNEITA--KPSGK 601
            :|..:.:..|.. :..|||...||:|. .|:..|...|.  ..:.|..|.|.....|.  ||.|:
Human   548 VAAMMNIKFQNI-VVEILIEHYEKIFHTAPDPSIPLPQP--QSRSGSRRTRAICLSTGSRKPRGR 609

  Fly   602 ASNVGVGHDSTVINKYSTN 620
            .:......||   :.||::
Human   610 YTPCLAEPDS---DSYSSS 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 61/232 (26%)
ARHGAP42NP_689645.2 BAR_GAP10-like 19..225 CDD:153318
BAR-PH_GRAF_family 267..376 CDD:269953 21/131 (16%)
RhoGAP_Graf 369..567 CDD:239839 58/231 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 575..720 14/56 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 749..777
SH3_GRAF3 820..874 CDD:212999
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.