DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and AgaP_AGAP008912

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_319660.4 Gene:AgaP_AGAP008912 / 1279880 VectorBaseID:AGAP008912 Length:629 Species:Anopheles gambiae


Alignment Length:164 Identity:47/164 - (28%)
Similarity:75/164 - (45%) Gaps:24/164 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 TDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQ-----KTELLYNELESTFYQNPDNLDNLFR 433
            :.|..:|..:...:.|:..||..|.||.|:.|.::     |.:.|:.:...|..|    :|    
Mosquito   376 SSSPRIPALIVHCVSEIENRGLTEVGLYRLSGSEREVRALKEKFLHGKTIPTLGQ----ID---- 432

  Fly   434 TATVHELSSLLKRWLRELPQPLLTNELIQLFYQC---HTLPSIDQMNALSILCHL---LPPENRN 492
               |:.|.|.:|.:||.|.:||:.|.|:..|...   .|.|:..| .....||.|   ||..||:
Mosquito   433 ---VNVLCSCIKDFLRTLREPLIPNALLGEFSSAVSGATSPNGGQ-RMRQQLCQLIERLPAPNRD 493

  Fly   493 TLRSLLSFFNIIINLKDINKMNVHNVATIMAPSM 526
            ||..|:..|..:.. .:..||.:.|:|.:.||::
Mosquito   494 TLAFLMLHFQRVAQ-SEAAKMPIDNLARVFAPTI 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 47/164 (29%)
AgaP_AGAP008912XP_319660.4 C1 305..353 CDD:197519
RhoGAP_MgcRacGAP 365..561 CDD:239847 47/164 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.