DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and AgaP_AGAP009730

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_318814.4 Gene:AgaP_AGAP009730 / 1279139 VectorBaseID:AGAP009730 Length:1581 Species:Anopheles gambiae


Alignment Length:167 Identity:36/167 - (21%)
Similarity:58/167 - (34%) Gaps:61/167 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DIRDVF--REFDEQGTVTRSRSATPDSLDSLQIDEAWTNNSLPTFVNVYEKNTETAIQCVEQSNE 171
            |||:.|  ..|||.|:|...::|                        :|:|.....:...|....
Mosquito  1338 DIRNKFSATSFDETGSVGTGKTA------------------------IYKKRQAPRVPMAEPEVP 1378

  Fly   172 I---YLKQNLRRTPSAPPKSGTYADIFRGSQVRCDIP--LYSADGVELLGYSRIGTIQFPRNRSV 231
            |   :.::.:::.|:..|            |||...|  :.....:||:|         .:|...
Mosquito  1379 IVAEFPQKGVKKRPAPQP------------QVRPITPTKINPIKEMELIG---------KKNTDE 1422

  Fly   232 SD------PFCSIGRSKESRSENDARSQKKKSSEVLS 262
            :|      ||...|.   .|..|..|:..|::||.||
Mosquito  1423 NDNSDDEPPFNFQGM---LRKTNYNRASMKRNSEGLS 1456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856
AgaP_AGAP009730XP_318814.4 PKc_like 9..284 CDD:304357
S_TKc 16..284 CDD:214567
MYSc 330..1051 CDD:214580
MYSc_Myo21 347..1039 CDD:276848
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.