DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and AgaP_AGAP004000

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_318459.5 Gene:AgaP_AGAP004000 / 1278822 VectorBaseID:AGAP004000 Length:2647 Species:Anopheles gambiae


Alignment Length:222 Identity:59/222 - (26%)
Similarity:99/222 - (44%) Gaps:22/222 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 LFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELEST 420
            ||||.:.||..     ..:|...:|..:.|||..:...|...||:.|..|...|.:.|..:::..
Mosquito  1933 LFGVPLTALCG-----NSSDGVKIPAQINKLIMMIEMHGLYSEGIYRKSGVSSKIKDLKAKMDRA 1992

  Fly   421 FYQ---NPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHTL-PSIDQMNALSI 481
            ...   ....:|  |.:..||.|:::||.:|||:|:||||.:....|.:...| ...|::..|..
Mosquito  1993 VTSADGGGGEMD--FESYNVHVLTNVLKSFLREMPEPLLTFDRYDDFLRAADLSDGSDRVQTLLS 2055

  Fly   482 LCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMF-PPRYIHPSDN-NSIAEQV 544
            |...:||.:......|:....::..|:..|:|:..::|.:.||.:. ..||:...|: |.|..|.
Mosquito  2056 LVKKIPPAHHCLFERLIFHLALVAKLEQYNRMSASSLAIVFAPCVLRTNRYVPAQDSLNDIGRQT 2120

  Fly   545 RMAAQCCRLTNILILRGEKLFQVPNNL 571
            :     |..|.|.    :|:..|.:.|
Mosquito  2121 K-----CMETLIT----QKMLNVKSTL 2138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 59/222 (27%)
AgaP_AGAP004000XP_318459.5 RA 16..85 CDD:214612
MYSc 120..779 CDD:214580
MYSc_Myo9 130..771 CDD:276836
IQ 836..854 CDD:197470
C1 1602..1643 CDD:237996
C1 1843..1891 CDD:237996
RhoGAP 1934..2127 CDD:295372 54/204 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.