DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and AgaP_AGAP003944

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_318402.5 Gene:AgaP_AGAP003944 / 1278773 VectorBaseID:AGAP003944 Length:1908 Species:Anopheles gambiae


Alignment Length:319 Identity:88/319 - (27%)
Similarity:141/319 - (44%) Gaps:57/319 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 ISETDMKRLQTILWLEL-----ATIFDRNKVSLDKRKPFK--RRR---KEEGN---LFGVSINAL 364
            :|.|.:.|...|..|.|     .||:.|    |....||:  |||   ...||   |||..:..:
Mosquito   862 LSLTTLLRQSPIHQLALKVEPRGTIYLR----LRHTDPFQLFRRRGLPSLRGNVPALFGADLETV 922

  Fly   365 IRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTFYQN----- 424
            :.|:.: .....:.||:.|.:.:.|:.|||....||.|:.|...|..|    |...|.:|     
Mosquito   923 VTRESK-GAPGCAPVPIILRRCVEEVERRGLDIIGLYRLCGSATKKRL----LREAFERNSRAVE 982

  Fly   425 --PDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQ----CHTLPSIDQMNA---LS 480
              |:::.:      ::.::.:||.:|||||:||.|..|.|:...    |  ||...:.||   ||
Mosquito   983 LTPEHVPD------INVITGVLKDYLRELPEPLFTKCLFQMTVDALGVC--LPDDPEGNAKLMLS 1039

  Fly   481 IL-CHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNSIAEQV 544
            || |  ||..||.||..||...:::::..:.|||:...:||.:.    ||..:| |.:....|::
Mosquito  1040 ILDC--LPRANRATLVFLLDHLSLVVSAAERNKMSAQALATALG----PPLMLH-SASVGANEEI 1097

  Fly   545 RMAAQCCRLTNILILRGEKLFQVPNNLIVESQKTMMGKKGWHRHRNSNEITAKPSGKAS 603
            ..|.....|..:|     :::..|............|::|.......|:.:|..:||::
Mosquito  1098 DHAQPIAVLKYLL-----QIWPQPGTGTGAPTSGNTGRRGEPVEPRGNKASALQAGKSA 1151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 65/234 (28%)
AgaP_AGAP003944XP_318402.5 PDZ_signaling 140..223 CDD:238492
C2 775..874 CDD:175973 3/11 (27%)
RhoGAP 915..1114 CDD:295372 63/223 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.