DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and AgaP_AGAP000865

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_316836.5 Gene:AgaP_AGAP000865 / 1277379 VectorBaseID:AGAP000865 Length:1535 Species:Anopheles gambiae


Alignment Length:226 Identity:58/226 - (25%)
Similarity:106/226 - (46%) Gaps:32/226 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 VVLISETDMKRLQTILWLELATI--FDRNKVSLDKRKPFKRRRKEEGNLFGVSINALIRRDQQVT 372
            |:.:|||          |.::||  |...:|:| :|.|    ..:.|.|||..:..:|:|:::. 
Mosquito  1302 VLQLSET----------LSISTIIRFVPGEVTL-RRVP----TSKPGALFGAKLQQVIKREKRD- 1350

  Fly   373 GTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLFRTATV 437
                  :|..:...:.|:.|||..|.|:.|:.|.......|....|:..|:    .:.|.:...:
Mosquito  1351 ------IPFIVSACVREVERRGMTEVGIYRVSGSASDVAKLKKSFETNAYE----AEQLLKEVDI 1405

  Fly   438 HELSSLLKRWLRELPQPLLTNE----LIQLFYQCHTLPSIDQMNALSILCHLLPPENRNTLRSLL 498
            |.::.:||.:||:||:.|.|::    |...|.:...|....:::.|..:...||..|:.|:..||
Mosquito  1406 HSVTGILKSYLRDLPEALFTDQYYPKLFDAFNRHSNLSEGTRIHELQRIFAELPQPNKATINLLL 1470

  Fly   499 SFFNIIINLKDINKMNVHNVATIMAPSMFPP 529
            .....:...:..|||::||:|.:..|::..|
Mosquito  1471 DHLMRVHQQEIENKMSLHNLAMVFGPTLLRP 1501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 45/178 (25%)
AgaP_AGAP000865XP_316836.5 RhoGEF 792..981 CDD:279015
PH_BCR_arthropod 976..1166 CDD:270174
C2 1208..1317 CDD:301316 7/24 (29%)
RhoGAP 1336..1531 CDD:295372 44/177 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.