DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and AgaP_AGAP013292

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_003436414.1 Gene:AgaP_AGAP013292 / 11175802 VectorBaseID:AGAP013292 Length:1097 Species:Anopheles gambiae


Alignment Length:325 Identity:74/325 - (22%)
Similarity:131/325 - (40%) Gaps:79/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 VLISETDMK-RLQTILWLELATIFDRNKVSLDKRKPFKRRRKEEGN-----------LFGVSINA 363
            |||::.:.| .|.|:|..||             ||...:.|||:.:           :|...::|
Mosquito     8 VLINDLESKDELYTVLLEEL-------------RKSGIKYRKEKNSKASQDKAKSKRIFKTPLHA 59

  Fly   364 LIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTFYQNPDNL 428
            |...|..:.......:|||:.... :|:......|||.|..|..::.:.:...|||..       
Mosquito    60 LELTDVLLASGGIVQIPLFVSNAC-QLILENVDTEGLFRKAGSNKRQQQIKAGLESGI------- 116

  Fly   429 DNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSI-----------DQMNALSIL 482
             .|.::..|.::::::|.:.|:||:.||         .|..:...           |:::.|.:.
Mosquito   117 -PLGKSHHVIDVANIIKTFFRDLPEALL---------PCGNVQEALIRCLIGGGNDDKVHKLMMT 171

  Fly   483 CHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNSIAEQVRMA 547
            |.||||...|||...:.|.:.:....|.|||...|:|.|:.||:.|           |.|.::..
Mosquito   172 CLLLPPLTLNTLAYFMQFLHTVSMHADKNKMTTENLALILTPSIMP-----------ITESIQQR 225

  Fly   548 AQC-CRLTNILILRGEKLFQVPNNLI------VESQKTMM-----GKKGWHRHRNSNEITAKPSG 600
            ... .|:..:||...:::..:|..::      :.|..:|:     .||  .:.|.|..:|...:|
Mosquito   226 FNSHVRVLQLLIEHSQQIGLIPEAILGQLKDDIGSNASMLMSNVTDKK--KKKRRSGSLTRMFNG 288

  Fly   601  600
            Mosquito   289  288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 52/237 (22%)
AgaP_AGAP013292XP_003436414.1 RhoGAP 52..251 CDD:295372 52/227 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.