DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and RALBP1

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_006779.1 Gene:RALBP1 / 10928 HGNCID:9841 Length:655 Species:Homo sapiens


Alignment Length:501 Identity:100/501 - (19%)
Similarity:169/501 - (33%) Gaps:158/501 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 IGTIQFP---RNRSVSDPFCSIGRSKESRSENDARSQKKKSSEVLSASENECGRLLPMPYNVLSF 281
            |...:||   |....|.|...:....:..|:::....|||            |:..........:
Human    33 ISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGKKK------------GKFKKKEKRTEGY 85

  Fly   282 ESICRDSSSLDSCEVLDTCDIPSTLFTDVVLISETDMKRLQTILWLELATIFDRNKVSLDKRKPF 346
            .:...|||.       |..:.||            .|||.:.|      .:|.:...|..|.|.|
Human    86 AAFQEDSSG-------DEAESPS------------KMKRSKGI------HVFKKPSFSKKKEKDF 125

  Fly   347 K------------RRRKEEGN------------------------------------------LF 357
            |            .:.|||.:                                          :|
Human   126 KIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIF 190

  Fly   358 GVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELL---YNELES 419
            |:.:...:.|....   |...:|....:.|..:.:.|.:.||:.|:.|.|.|.:.|   |:..||
Human   191 GIPLADAVERTMMY---DGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREES 252

  Fly   420 TFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQ-CHTLPSIDQMNALSILC 483
            |      ||:: :...||   :||||::||:||:.|||.||:..|.: |......:::.....|.
Human   253 T------NLED-YEPNTV---ASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKVQEFQRLL 307

  Fly   484 HLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPS----------------------- 525
            ..||..|...:..|:...:.:|..:...|||:.|::.:::|:                       
Human   308 KELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVV 372

  Fly   526 ----MFPPRYIH-------PSDNNSIAEQVRMAAQCCRLTNIL----------ILRGEKLFQVPN 569
                |.|.|:.:       |.....|.|::|...   .|.|.|          :.:.|:|::|..
Human   373 LKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQE---FLLNCLHRDLQGGIKDLSKEERLWEVQR 434

  Fly   570 NLIVESQKTMMGKKGWHRHRNSNEITAKPSGKASNVGVGHDSTVIN 615
            .|....:|....|:.....:.:.||.:......|...:..:..|||
Human   435 ILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 62/267 (23%)
RALBP1NP_006779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..158 30/161 (19%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q9PT60 102..119 5/22 (23%)
Mediates association with membranes and could form transmembrane domains. /evidence=ECO:0000269|PubMed:15610018 154..219 6/67 (9%)
RhoGap_RalBP1 190..371 CDD:239846 48/193 (25%)
SMC_N <400..>627 CDD:330553 17/84 (20%)
Mediates interaction with RALA and RALB. /evidence=ECO:0000269|PubMed:20696399, ECO:0000269|PubMed:7673236 403..499 16/81 (20%)
Mediates interaction with REPS1 and REPS2. /evidence=ECO:0000250|UniProtKB:Q62796 500..655
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..551
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 601..655
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.