DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and arhgap39

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_009293293.2 Gene:arhgap39 / 101884459 ZFINID:ZDB-GENE-041014-247 Length:967 Species:Danio rerio


Alignment Length:567 Identity:117/567 - (20%)
Similarity:195/567 - (34%) Gaps:199/567 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LHHSDDQDFSEFLNEYYLQSNSQSIEPEASYEDGEMEAEWLVSAG-YPELT--KPFEQGLEVSKK 68
            ||.|..:|... .:::....|::::.|.|             |.| :||.|  ||      .|:.
Zfish   532 LHPSQSEDLGA-CSQFEASRNARNMMPSA-------------SCGIFPEFTLRKP------SSET 576

  Fly    69 DLEPILTTLSKPHAEAIVQLVRTLNKTVRVRTKSRPKRKPDI----RDVFRE----FDEQGTVTR 125
            |:|...:.....|.:.:.:  |.::....:...|.|.:||.|    |.|.||    |....|...
Zfish   577 DIENWASKHFNKHTQGLFR--RKVSIANMLAWSSEPIKKPMIMTSDRTVKREAVDLFKLIQTYMG 639

  Fly   126 SRSATPDSLD-SLQID-EAWTNNSLPTFVNVYEKNTETAIQCVEQSNEIYLKQNLRR-------- 180
            .|.|..|.|. :|::. ..|:...|         ..|..||...|:.|.:...:|:|        
Zfish   640 DRRAKADPLAVALEVAVRGWSCQGL---------RDELYIQLCRQTTENFRYDSLQRGWELMAIC 695

  Fly   181 ---TPSAPPKSGTYADIFRGSQVRCDIPLYSADGVELLGYSRIGTIQFPRNRSVSDPFCSIGRSK 242
               .|..|    .:.:...|...|...||....||.:..|::               :|.....|
Zfish   696 LAFFPPTP----RFHNYLEGYIYRHMDPLNDTKGVAISSYAK---------------YCYRKLQK 741

  Fly   243 ESRSENDARSQKKKSSEVLSASENECGRLLPMPYNVLSFESICRDS---SSLDSCEVLDTCDIPS 304
            .:.| ...:..||.|.|.::.:.|                :|.|.|   |||:.           
Zfish   742 AALS-GAKKGLKKPSVEEIAYARN----------------AIFRPSMFGSSLEE----------- 778

  Fly   305 TLFTDVVLISETDMKRLQTILWLELATIFDRNKVSLDKRKPFKRRRKEEGNLFGVSINALIRRDQ 369
                  |:..:.:....|.:.|::                                    .|..:
Zfish   779 ------VMAMQKERYPDQQLPWVQ------------------------------------TRLSE 801

  Fly   370 QVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLFRT 434
            :|.|.:                  |.:.||:.|:.|...:...|  :|:...::.|..|::    
Zfish   802 EVLGLN------------------GDQTEGIFRVPGDIDEVNAL--KLQVDQWKVPTGLED---- 842

  Fly   435 ATVHELSSLLKRWLRELPQPLLTNELIQLFY-QCHTLPSIDQMN------ALSILCHLLPPENRN 492
              .|..:||||.|.|||.:|::.:|    || ||       .||      |::::.: ||..|:.
Zfish   843 --PHIPASLLKLWYRELEEPVIPHE----FYEQC-------VMNYDSPAAAVNVVLN-LPHINKL 893

  Fly   493 TLRSLLSFFNIIINLKDIN--KMNVHNVATIMAPSMF-----PPRYI 532
            .|..|:.|..:......::  ||:|.|:|.:|||:..     .||.|
Zfish   894 VLCYLIRFLQVFAQPASVSMTKMDVSNLAMVMAPNCLRCQSDDPRVI 940

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 47/191 (25%)
arhgap39XP_009293293.2 WW 4..>72 CDD:320787
MyTH4 650..759 CDD:307090 26/137 (19%)
RhoGAP_KIAA1688 772..957 CDD:239854 53/260 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.