DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and arhgap5

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_004917331.1 Gene:arhgap5 / 100499209 XenbaseID:XB-GENE-982380 Length:1500 Species:Xenopus tropicalis


Alignment Length:283 Identity:62/283 - (21%)
Similarity:112/283 - (39%) Gaps:57/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 KVSLDKRKPFKR------RRKEEGNLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGS 395
            ||..||:|...:      ||..|.|.||..::.|:..::.        :|:|::|.:..:...|.
 Frog  1230 KVKEDKKKKKTKQLNPPTRRNWESNYFGKPLHELVSPEKP--------IPVFVKKCVEYIEETGL 1286

  Fly   396 REEGLLRIGGHKQKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNEL 460
            ..|||.|:.|:|...:    .::..|.|: :||:......||:.::..||.:..:||.||:....
 Frog  1287 SAEGLYRVSGYKTDQD----NIQKQFDQD-NNLNLASMEVTVNAVAGALKAFFADLPAPLIPYNH 1346

  Fly   461 IQLFYQCHTLP-SIDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVA----- 519
            .....:...:| .::::..|..:....||.|...||.:::..|.:......|.|...|::     
 Frog  1347 HPDLLEASKIPEKVERLQVLKDILRSFPPVNYEVLRFIIAHLNRVSQHSKTNLMTADNLSICFWP 1411

  Fly   520 TIMAPSMFPPRYIHPSDNN-SIAEQVRMAAQCCRLTNILILRGEKLFQVPNNLIVESQKTMMGKK 583
            |:|.|......:...:.|: |:.|  ....||    ......|:         ||:|...     
 Frog  1412 TLMRPDFENKEFFSTTKNHQSVIE--TFILQC----QFFFYEGD---------IVDSPSA----- 1456

  Fly   584 GWHRHRNSNEITAKPSGKASNVG 606
                       |:.||.:.|:.|
 Frog  1457 -----------TSSPSAQHSSPG 1468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 47/226 (21%)
arhgap5XP_004917331.1 P-loop_NTPase 28..244 CDD:393306
RhoGAP-FF1 260..339 CDD:374593
FF 430..482 CDD:128718
FF 485..547 CDD:128718
P-loop_NTPase <658..736 CDD:393306
RhoGAP_p190 1256..1440 CDD:239838 42/198 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.