DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and chn2

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_002933428.2 Gene:chn2 / 100496459 XenbaseID:XB-GENE-950874 Length:467 Species:Xenopus tropicalis


Alignment Length:220 Identity:55/220 - (25%)
Similarity:105/220 - (47%) Gaps:38/220 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 IRRDQQVTGTD-SSLV-------PLFLEKLIGELLRRGSREEGLLRIGG---HKQKTELLYN--- 415
            ::|.::|...| ::||       |:.::..|.|:..||.:.|||.|:.|   |.:..::.::   
 Frog   267 LKRIKKVYSCDLTTLVKAHNTPRPMVVDMCIQEIEGRGLKSEGLYRVSGFTEHIEDVKMSFDRDG 331

  Fly   416 ---ELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSIDQ-M 476
               ::.||.|  ||          ::.::..||.:.|:||.|::|.:....|.:...:.:.|: :
 Frog   332 DRADISSTLY--PD----------INIITGALKLYFRDLPIPVITYDTYYKFMEASKISNADERL 384

  Fly   477 NALSILCHLLPPENRNTLRSLLSFF-NIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNSI 540
            .|:.....||||.:..|||.|:... .:.:|.|| |.|...|:..:..|::     :.|.:.|::
 Frog   385 EAIHEALMLLPPAHYETLRFLMIHLKKVALNEKD-NLMGSENLGIVFGPTL-----MRPPEENAL 443

  Fly   541 AEQVRMAAQCCRLTNILILRGEKLF 565
            |....|..| .::..:||...:.||
 Frog   444 ASLNDMRHQ-KQIVQLLIQNEDVLF 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 55/220 (25%)
chn2XP_002933428.2 SH2_a2chimerin_b2chimerin 52..138 CDD:198215
C1_betaCHN 209..269 CDD:410407 0/1 (0%)
RhoGAP_chimaerin 274..467 CDD:239837 51/211 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.