DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and arhgap11a.1

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001121463.1 Gene:arhgap11a.1 / 100158559 XenbaseID:XB-GENE-1010876 Length:946 Species:Xenopus tropicalis


Alignment Length:234 Identity:64/234 - (27%)
Similarity:113/234 - (48%) Gaps:28/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 GNLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELE 418
            |.:||..:::|..:.....|.    ||:.| .::.:.|.:....|||.|..|...:.:||..:: 
 Frog    48 GKVFGTPLHSLPYQYLPEYGN----VPVIL-VIVCKSLEKHLNTEGLFRKSGSVARQKLLKTKI- 106

  Fly   419 STFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQC-HTLPSIDQMNALSIL 482
                   ||.:|...||...:::.:||::.||||:|:|..:|...||:. |.....::::|..:|
 Frog   107 -------DNGENCLTTALPCDVAGILKQFFRELPEPVLPTDLQDAFYKAQHLSTDSERISATMLL 164

  Fly   483 CHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNN-----SIAE 542
            ..|:|......|:...||.:.:....|.||||.:|:|.|.||::     :|.:|:.     |..:
 Frog   165 TCLIPERTVQILQYFFSFLHAVALRSDANKMNSNNLAVIFAPNL-----LHSNDDGEKISPSTEK 224

  Fly   543 QVRMAAQCCRLTNILILRGEKLFQVPNNLIVESQKTMMG 581
            ::|:.|...|   .||.:...:..|| :.|.|....|:|
 Frog   225 KLRVQAAVVR---TLIDQAADIGCVP-DFITEKIPGMLG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 61/225 (27%)
arhgap11a.1NP_001121463.1 RhoGAP-ARHGAP11A 50..250 CDD:239859 59/221 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.