DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and capn15

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_031748342.1 Gene:capn15 / 100127702 XenbaseID:XB-GENE-5926484 Length:1051 Species:Xenopus tropicalis


Alignment Length:466 Identity:93/466 - (19%)
Similarity:148/466 - (31%) Gaps:165/466 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 RTKSRPKRKPDIRDV---------FREFDEQGTVTRSRSATPDSLDSLQIDEAWTNNSLPTF--- 151
            |..|.||..|:...|         |:..:|.||.......:...|.||.:.....|..:|..   
 Frog   201 RKLSLPKIPPEALVVPEIVPPPAAFQGSEEPGTAPLREQDSSRPLPSLPLSPGPHNAPVPRSRRE 265

  Fly   152 ---VNVYEKNTETAIQCVEQSNEIYLKQNLRRTPSAPPKSGTYADIFRGSQVRC---DIPLYSA- 209
               .|....:|...|:..::.:  .|::.:.....||..:..|:...|.:..:|   :||..|. 
 Frog   266 VAPDNPLSPSTSGPIRLPKRLS--VLEEEMPTAEQAPTPTEPYSPDSRWACGKCTLRNIPTASRC 328

  Fly   210 ---------DGVELLG-------YSRIG--TIQFPRNRSVSDPFCSI------------------ 238
                     ||...:|       .|..|  .:..||....:.|.|::                  
 Frog   329 RACGAVRGNDGEPGMGGLDALPSPSSTGLLPVSAPRKTQWACPACTLLNDNGVTHCAACHTPQRY 393

  Fly   239 -----GRSKESRSENDARSQKKKSSEVLSASENECGRLLPMPYNVLSFESICRDSSSLDSCEVLD 298
                 .:::..|.....|::.::.::     |.|...|..   |::||   |||.||..|     
 Frog   394 ITQHHMKTRVLRRRESVRAETRRQTD-----EGEAKELWE---NIVSF---CRDLSSYLS----- 442

  Fly   299 TCDIPS---TLFTD--------VVLISETDMKRLQTILWLELATI----FDRNKVSLDKRKPFKR 348
                ||   ..|.|        .|...|||..:|:...||....|    |....|   |...|:.
 Frog   443 ----PSQNTVNFVDDSFPPGPRSVGFPETDSVQLRVKQWLRPQEINCSSFKERSV---KWTVFRT 500

  Fly   349 RRKEE------GNLFGVSINALIRRDQQVT----------------------GT----------- 374
            .|..:      ||.:.:|..|::....::.                      ||           
 Frog   501 PRPSDILQGLLGNCWFLSALAVLAERPELVERVMITRTICPEGAYQVRLCKDGTWTTVLVDDMLP 565

  Fly   375 -DSSLVPLF------------LEKLIGEL------LRRGSREEGLLRIGGHKQKTELLYNELEST 420
             |.:...||            :||.:.:|      |:.|...|||..:.|  ...|.|..::.||
 Frog   566 CDEAGYLLFSQAQRKQLWVALIEKALAKLHGSYFALQAGRAIEGLATLTG--APCESLMLQVSST 628

  Fly   421 FYQNP--DNLD 429
               ||  :|:|
 Frog   629 ---NPREENVD 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 24/128 (19%)
capn15XP_031748342.1 RanBP2-type Zn finger 67..86 CDD:275375
RanBP2-type Zn finger 107..132 CDD:275375
PHA03247 <140..390 CDD:223021 36/190 (19%)
RanBP2-type Zn finger 178..197 CDD:275375
RanBP2-type Zn finger 255..274 CDD:275375 3/18 (17%)
RanBP2-type Zn finger 312..331 CDD:275376 4/18 (22%)
RanBP2-type Zn finger 368..387 CDD:275376 2/18 (11%)
Peptidase_C2 450..753 CDD:395523 41/195 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.