DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14464 and arl14ep

DIOPT Version :9

Sequence 1:NP_001036466.2 Gene:CG14464 / 3355132 FlyBaseID:FBgn0033000 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001074222.1 Gene:arl14ep / 751672 ZFINID:ZDB-GENE-060825-216 Length:224 Species:Danio rerio


Alignment Length:112 Identity:38/112 - (33%)
Similarity:61/112 - (54%) Gaps:11/112 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KPYLDSDYSISRNLRQRHRKKGVSNEYSNYLDSENKKKGRKKCQNSAYDEYGNIRSNGLDICDCM 66
            :|..||... .|.:..|.|..|       .|.|.:::.  ...::..||..|.:.|.|.|:|||:
Zfish   122 QPIRDSSMK-GRGMNDRRRGGG-------KLSSIDRQS--LSLKSKVYDSKGMLISCGKDLCDCL 176

  Fly    67 NQECDGCWYNCRSCGSTRCGPQCRSNRKFFYEDITYDGKDLNIQNKY 113
            :.:|.||:|.|..|||.:||.:||.:||:.||.:..:|.:: |:||:
Zfish   177 DVDCMGCFYPCPECGSRKCGVECRCDRKWLYEQVEVEGGEI-IRNKF 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14464NP_001036466.2 ARF7EP_C <16..103 CDD:291610 30/86 (35%)
arl14epNP_001074222.1 THAP 4..82 CDD:214951
ARF7EP_C <131..213 CDD:291610 31/90 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9752
eggNOG 1 0.900 - - E1_KOG4850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056242at2759
OrthoFinder 1 1.000 - - FOG0004362
OrthoInspector 1 1.000 - - otm26156
orthoMCL 1 0.900 - - OOG6_107772
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3336
SonicParanoid 1 1.000 - - X3647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.