DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14464 and ARL14EPL

DIOPT Version :10

Sequence 1:NP_001036466.2 Gene:CG14464 / 3355132 FlyBaseID:FBgn0033000 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001182510.1 Gene:ARL14EPL / 644100 HGNCID:44201 Length:152 Species:Homo sapiens


Alignment Length:94 Identity:34/94 - (36%)
Similarity:53/94 - (56%) Gaps:12/94 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RQRHRKKGVS--NEYSNYLDSENKKKGRKKCQNSAYDEYGNIRSNGLDICDCMNQECDGCWYNCR 78
            ||:.:|..:|  |||.:     .|.|..:|     ||:.|.:..|..|:|||:.:.|.||:|.|.
Human    59 RQQKKKARMSKMNEYFS-----TKYKIMRK-----YDKSGRLICNDADLCDCLEKNCLGCFYPCP 113

  Fly    79 SCGSTRCGPQCRSNRKFFYEDITYDGKDL 107
            .|.|.:|||:||.||::.|:.|..:..::
Human   114 KCNSNKCGPECRCNRRWVYDAIVTESGEV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14464NP_001036466.2 ARF7EP_C <18..103 CDD:464395 32/86 (37%)
ARL14EPLNP_001182510.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
ARF7EP_C 36..138 CDD:464395 34/88 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.