DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14464 and ARL14EPL

DIOPT Version :9

Sequence 1:NP_001036466.2 Gene:CG14464 / 3355132 FlyBaseID:FBgn0033000 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001182510.1 Gene:ARL14EPL / 644100 HGNCID:44201 Length:152 Species:Homo sapiens


Alignment Length:94 Identity:34/94 - (36%)
Similarity:53/94 - (56%) Gaps:12/94 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RQRHRKKGVS--NEYSNYLDSENKKKGRKKCQNSAYDEYGNIRSNGLDICDCMNQECDGCWYNCR 78
            ||:.:|..:|  |||.:     .|.|..:|     ||:.|.:..|..|:|||:.:.|.||:|.|.
Human    59 RQQKKKARMSKMNEYFS-----TKYKIMRK-----YDKSGRLICNDADLCDCLEKNCLGCFYPCP 113

  Fly    79 SCGSTRCGPQCRSNRKFFYEDITYDGKDL 107
            .|.|.:|||:||.||::.|:.|..:..::
Human   114 KCNSNKCGPECRCNRRWVYDAIVTESGEV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14464NP_001036466.2 ARF7EP_C <16..103 CDD:291610 34/88 (39%)
ARL14EPLNP_001182510.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
ARF7EP_C 36..138 CDD:405617 34/88 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9146
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5338
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056242at2759
OrthoFinder 1 1.000 - - FOG0004362
OrthoInspector 1 1.000 - - otm41433
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3336
SonicParanoid 1 1.000 - - X3647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.